SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|116410|estExt_Genewise1Plus.C_860025 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|116410|estExt_Genewise1Plus.C_860025
Domain Number 1 Region: 589-784
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000858
Family Integrin A (or I) domain 0.048
Further Details:      
 
Domain Number 2 Region: 15-87
Classification Level Classification E-value
Superfamily RING/U-box 0.000000379
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|116410|estExt_Genewise1Plus.C_860025
Domain Number - Region: 311-446
Classification Level Classification E-value
Superfamily PH domain-like 0.00197
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|116410|estExt_Genewise1Plus.C_860025
Sequence length 1109
Sequence
MVAAPLPVVSSHDATDDEDECPVCLEPLSFSFRLPGEKPHIVPECGHALHEACFTAVYGP
PPAPSRAGNVIRKSNLGVCGVCRRPMKVGDGDGGKSNKLAALTGMGNPNGASLFPGRDTP
SSVRSFNPRSPHGQPPQPYDPTQDDPVEHEHHAKASAPQPDQSHYIVSPSIQVRSEFASI
TRTGESSQPLTCIVVIELPGKRLSSHVPGSVMHMSDAYPQRGAGGYQPDARSVRSSPMPE
YAGSGHGGIPSDRQSGPGSQHMSPVSSHERHLSPADDMSPPPHHHAHAPPPPPEESPFNA
ITEDLRARIIDWKGHPLAGLGPLQMYDLLSVRRDAMVREFYVYLFREAIICVVEEKRRTL
GRLLSTASGQAGFGEGPGPGQNAQQKGVLRLKGRIYIRHIKQVTDTSVAGELSLTIDMED
ERLDSFILIFKDRPSLETWKAHVQALVAVYQQQSAAAQGRDSTGGQSSVGGPDLEEFGGS
AKAARMLHEEFGGSQKAMRMLSGSTGTTVSTTDSLLLNGSARSTASSHTSYGSSSSQSHS
AYPHARTLQHKLSTLEEDEEFSRYSSPTPLVAPHMSAGPSNSLAPLPHPPLDLILVVSVP
SPTATPSTAALKVRVIRASLDFIVASLGPKDRLSLVTFEVGIGGRVRKTPFLSPGKPQSK
ARLRKFVDEIGRREDGTPFEDEFLVRGSQDDKTDVVTAVNHGLDVVLQRKSRNPVTGMIL
VSDTAETTRRAQMDLVLARTEAANVPIHSFGYGRAHDPASLWLMSNHTSGTYTFVKDWYD
LRDCLAGCIGGMMSIGLLHMKLHMKIVDGQRFRIRKISGGPMAILSSDGRDVDVELGELR
YGERKEMLVELELDNSDVIQSPIAALQNSNQAQRPLNATDQFMGRMGLDSLSIADLPDLA
DGMMDRMIDEVPVFEVDGSFFDPAAAKHVSRLAHPVLLTVTLLPNSGSRPRTPAANGSDP
VIVRRRMELLASDMITRALVLVSRKNLPQAQKLLSETRRILHTVLQNITQSLPPPNAQGG
TARNRKEILTLSAVRAIQAVLQDMQILSEALDDNPDFFAHDQRNFGAQQAMVLRDQKSWS
GRSAIERLFWTIDNSIELVSRSTDWVARE
Download sequence
Identical sequences 104341.JGI116410 jgi|Pospl1|116410|estExt_Genewise1Plus.C_860025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]