SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|118649|estExt_Genewise1.C_410103 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|118649|estExt_Genewise1.C_410103
Domain Number 1 Region: 134-237
Classification Level Classification E-value
Superfamily Homeodomain-like 3.76e-34
Family SWIRM domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 393-443
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000142
Family Myb/SANT domain 0.05
Further Details:      
 
Domain Number 3 Region: 327-367
Classification Level Classification E-value
Superfamily RING/U-box 0.000000247
Family ZZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|118649|estExt_Genewise1.C_410103
Sequence length 725
Sequence
MSSPKRTASPSPNNDAKRIKLTVPQQNQGATAVDPENAPGKKSELEPIQGGDIGNLPPDD
ASEPSREPASAVSVRVLKAEGEGEDGGDVSMAEGVDAVDEEADSGEENDEEDPAQLEATR
LRLEEQAQKYLAAQTHEVIIPSYSAWFDMSKIHPIERRALPEFFNSRHRSKTPSIYKDYR
DFMVNTYRLRPSEYLTVTACRRNLAGDVCAIMRVHAFLEQWGLINYQIDPDQRPAALAPP
FTGHFRVILDTPRGLQSLHPGTRPTNQSTAAGINGAVKPGSSATPASVELRSSIYQTTAK
SSRQVNAAEANALTNGANAPNGQERPMVKYQCDTCGVDCTQERYHSLKQKNFELCPPCYL
DGRFPSTMFSGDFVKLTAASTASGLHHGSGTGADDDWTDQEILLLLEGVEMYDDDWSAIE
EHVGSRSAQQCIRKFLQLPIEDPYVATEGDMGPLRYARIPFEQADNPVMSVVAFLAGVIN
PGVAAEAAKTALHALTDGNVKDAEDGENKKEEQSAGTVGEAEGDSEKPDVSMEDAQRDSS
VVQPAEGDNAERQQPENSDMAVDSEAGQSKPTQGIPHSKVVRAANLALKASAKAANKLAN
AEDTQIRSTLATLIQLTLTKLELKMAQFEELEELLEDERRNLESQRMALVNERTTLRKTL
DNVRTELGKHNQGSSTPGALNAAASQAQSALNQSGQGARVSEVPGGAPAQGDMGPVSGGN
VAQLS
Download sequence
Identical sequences jgi|Pospl1|118649|estExt_Genewise1.C_410103 104341.JGI118649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]