SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|119164|estExt_Genewise1.C_140307 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|119164|estExt_Genewise1.C_140307
Domain Number 1 Region: 317-367
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000454
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|119164|estExt_Genewise1.C_140307
Domain Number - Region: 156-354
Classification Level Classification E-value
Superfamily FdhE-like 0.00863
Family FdhE-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|119164|estExt_Genewise1.C_140307
Sequence length 370
Sequence
MEFFNDVGGDPLKPTLFELIAQEQLRDLLQPALKYVLSVFAQRYPRYLLRIVNRHEEFYA
LLMLLVERHHLRTHGASFSENFYGLKRRRRPIFETERAKAAVPGVLPEEKLRDREIWRSL
LILVGLPYLRTKAHEYFEDLGGGVQSEVMEESLVNQTRALSEESLAGRLRRMYKAVYPWL
NTSFEAWLFLYNVAYLFDRTPFYRPWLSWIGVDIRRVGIDDLRAVQQAMKPSVGGTGPRS
LLAILRRLLLASPRMLLNSINVMLPTAIFFVKFLEWWYSPSSPARALSSSPQGPAVPAPI
LAKPHPQGIRLDHTAYGVCPLCGDGFANATAVPSGYVFCYRCAYEYVDKHGRCPVTLVPA
RVWQLRKILI
Download sequence
Identical sequences jgi|Pospl1|119164|estExt_Genewise1.C_140307 104341.JGI119164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]