SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|119633|estExt_Genewise1.C_1760017 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|119633|estExt_Genewise1.C_1760017
Domain Number 1 Region: 841-912
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000471
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 2 Region: 339-508
Classification Level Classification E-value
Superfamily ARM repeat 0.000000155
Family Clathrin heavy chain proximal leg segment 0.024
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|119633|estExt_Genewise1.C_1760017
Domain Number - Region: 22-181
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00114
Family WD40-repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|119633|estExt_Genewise1.C_1760017
Sequence length 953
Sequence
MVERKGILITLGEEDTARHPFLKVWDLEHTDNKTGLPALLRSTKVQSGNRPHPVSTIALS
ATLAYLAIGLGDGTVLLYRHLDQSIFSGSTSLSALPKPRVVHESAGEPITGLGFREPGED
SPNMYLFIVTLNRVLAYHASGKGSGGQPTVVSELGCGLGCAAMDGNSGDMVVARDEAIYV
CGIDSRGSSFAYEGKKVAVHTHRNYMIIISPPIAPSVTAASATVRNLAAKSKSTDNAEIT
KLTVFDLENHFVAYTGTFTTGIREVFSVFGQIYALANDGSLSCLEEKPTSAKLDMLYRKS
LFLTALNVAKTQGLDPGEVADVQRRFGDHLYAKADYDGAVQQYLKTIGHVQPSYIIRKFL
DAQRIHNLVTYLQELHSLGRANSDHTTLLLNTYTKLKDVSRLDAFIKRESARATDELPFD
LDTAIRVCRQAGYFEHASYLAKKYERHEDYLRIQIEDAGNYKDALSYLRRLGTEAAESNL
ARYGRAMLNNLPYETTQLLIDICTSLEPLMFDDDEPKGEPAALTRQPSTSGGPSYLSYLA
LNRNAAPGSSSATASDQGPVAPSSASTTTVKPGAASPVKPTVHSVKRPSPRLFFAHFVDH
LDCFVSFLETVALKRWGQTVDAIANGSVEVESDSNALEEAERQDQVSVWNTLLELYLAPG
PTTAERQANQDKALRVLRSEGGRIPYDPTHALILCSTCGFTQGLVPLWERAGMHEDILRF
WMDEHRSSAESSEESAASEEVVRALRLYGPTHPSLYALVLRFLTSEPALLRKHEEDVKDV
LREVEERGVMQPMEVVRVLGRNNVVGVGIVRSWLARVITEGRQAVNVDQQLIDSYRGETQ
AKLKQVQELSDPDRPRVFHVTQCAVCQGQLDLPSVHFMCGHSYHQRCLGEHETECPNCAR
AHGLIREIRQNNERLVDQHDVFLQEVREGGFSALAAGFGRGAMNLARLEDAVV
Download sequence
Identical sequences jgi|Pospl1|119633|estExt_Genewise1.C_1760017 104341.JGI119633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]