SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|119743|estExt_Genewise1.C_160108 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|119743|estExt_Genewise1.C_160108
Domain Number 1 Region: 3272-3631
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.01e-125
Family Hect, E3 ligase catalytic domain 0.0000000787
Further Details:      
 
Domain Number 2 Region: 1288-1339
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000108
Family UBA domain 0.01
Further Details:      
 
Domain Number 3 Region: 325-498,525-660
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000292
Family Armadillo repeat 0.047
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|119743|estExt_Genewise1.C_160108
Domain Number - Region: 1467-1652,1925-2019
Classification Level Classification E-value
Superfamily ARM repeat 0.00691
Family MIF4G domain-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|119743|estExt_Genewise1.C_160108
Sequence length 3638
Sequence
MRILHKSKKPLAPLPQVTELIEKLLETPDEDLAEVLGQIDSWKWPRSDLNAWIKVLNKFD
AILEEVIRDYDIDKLQVNALTPTTKKTVCEILRFERLLLENSTNRKTFNSYDRLNSLMFT
SDLDVLILALNLLLRPAQQYSSQPAVLHALSISTPRLTSLAKRWPNLRDYDVNLADLVSE
KGKAQVEALPNEAREVNFIFYRQPTSGASTVKAATATDAHTPDAAPQTPVRGRVISSSNV
AATPGTSTGAVTIHIDSKIIESREPMDILADTIEAYSVPDSEKFELLTRIRAARALTSTH
AADREKLVTVRLLATAIFGHTHQESQAQSLLLLYEPDLITHVAELLQLDRGVDVQIQTAA
IAALDALGRYRTKIQDVLTAVNAGVNHGILMALLRKTVAEVAQPSSTLPQSFVEALLSFV
TFIATHASGGNMVVGAGLLPLLIQVTENRLSNRLYVVSKTMQLLDNVLYGFNNAFQLFCN
ARGVEILVERIKYEVDLDLLEHSGDEPSQEIIASFGKLPVARTAVLKHTLRSIHRMMQSS
GTAEGLRGLLDSSLLKSVKKIMENRSVFGPSILPIAINIMATFVHNEPTCLPVLQEAGLS
EVFYTLVESGLEPVIEVIQAVPNAIGALCLNQAGQDQLTARPNIIPGLFSIFTSERHQRV
LQEKENSVLIGTAIEELIRHHPALKQSVFDAIKSTMDKIIELGNNYIPPSDIKHWYMLVP
SHPSASSSGVRPADTDVLMAPADIEGAQPTATNGPDIVIESTTSQRDDTLHRAHDNVIVS
YIDVLGKFLEGFFQCIPHCKDFIADQEALYRLGRLTALPCLPYDFANSVASDSLVQVIRT
MAEASTLETIAFLVSLVHQSLEDTKQFWAEMEERSRLLPFADIAGSAENEQANAQVRQLV
ILHIRTSLLSDIYATAGYSHGRATTSLLQSLTGSSSHDVLPRLGALHRACVWENIVLKAG
LGSPGTELTAARDMMSPELQTPPTVTASGTPNMGQADTSAGPSGATNGIPGDSSSISAPK
QEATRKEVPKEQNVKILKHLASQIPSALAPFFQAVVRLFQSRRNADPGHKQKIRETSSIV
ADVMVKHLAQLSFSDKLSVFAYYTVMLGLTTILLVDERTSQKTVYTALLVAFNQAKGLDT
IHHVSRSFIVTIQAVTLLDEEARSAAAKQELLHAYGGLKVALHLLHPLISSKPLFESAQT
ALITTSDKKETEPDYFEPHNFFVKMRVAVIPLLRDLWEASWLVTAPLGLIKSIVLAAMEI
LNVEGEEIKDASHGSSSTLISGGFTISRATGPDETRIRQLTDMGFPRSAAERALARTRNN
INAATELLLAHPFPYPPDPGPNEPAAQDPPAEDSGNSEVSTGDSSTQASDDNSAASPSED
ATDTVKSVEEWLKELNTSREALKVGLGKQALRLVDEHPSLVFDVQKIFVGFADGYREQAV
HQLIDDIKAFSPSAYDVQEQPMGVRCRLLALVLSDSSSPLSQMPDAEAKSLMDILLSLLL
SNPAGADGHPNIPKWLAAHLLVAEALLVLGNDPRSISLPKETEAIPDEPLTTGRRYPEGR
AILFDFCLRLLALPSLPKDELLSSLRLFVLLTEDHQMAQDFLRREGVTLLFQYLKISAGT
PSAAGIQSHIAIILRHVVEDGPTIRHIMHQEIRRFFAHPRNRAVDVGSYVAGCNALALRD
PAAFVETTREICQLSQPFSSVKSISLRAVSKQEVAVKQDTDRSGEVAGKNNDMQIDVDPI
AAPRQLSVETAESLIHFLIGELVKSVKENELSTAPSPEVSKAAPSGAAELSPITSLSAPE
TSTQGTGASNDRGENIYACFLMQCLTELLFSYDSCKLAFLSYSPKKRTQTPSKDTSLKHR
TAAINFFLSDVMSFGTINPQAPAEAKRRISLCNWAMSIIVALCVDTAFSQDIKDVAPELV
SVRKFVLEAVSRALKDLPTSEDPEARYSRLLALADLCHRLLTVRFNTTARKPSEDMPTHI
AKVMLEKNFVATLTNALADVDLNYPHIRGVVSAILRPLEYLSKIAIKMSRVSDKVKDSFD
EKIEDNESIPTDEDDTEEAENDDTPDLYRNSSLGLCVPFCEMEDVNYGAEDGMDEDEEDE
EDDVEMDFGDETGSEDTSATEEDVEDDLEDDLEDDGTGESEEGWQDEEEEDEEDLVENHE
VNANEEGEEQEGDEDEGEEVIWQDIAAGEDIAEDAADDADEDEEVGGECVPLYVMNISKS
VIDSVPILHMDMDEEAEVASEEDECVLNISLPADSLIIYIIAVNGITHLTRRFVADDDLE
IFGRPRHSNGTSGEAAIHPLLIDPASATTRGSANTRNVRRYQRGLTAPRDPHDLIQTIED
AIGESAMQFFHHIISHGREGGGETIHIDVPSGALAPLQRNGRAISASIRLERAPRSGDGR
TDVRGLDPLLTVQRWLEEVKMLHGRFEQGRLTKLSNHVILALLPAAVEAIKQARIAQEQE
AAHKREEEAKAEAEKAAKEEADKVAKEKEEAERLKMEAEESQQASSLTEGSMSDVQVTQP
VSTSPDVDTEMADVSEEGPSGEISGSDAEPATATTADGEQQMASGSSDEAVERVTVMIHG
SQVDITDTGIDPTFLEALPDDMREEVLNQHVRDQRAARVERPADSHISPEFLDALPPEIR
AEIIQQESLERTRQQVEANQGQGGAPAEIDPASFIASLDPQLRQVVLMDSDDVFIQSLPS
HMLAEAGIHRRDVRPPRVPPTRPADIRSPSSAPQQTQKPPTQRDAIQLLDKSSMAILVRL
LFFPQTLKKTLLYKVLVNLCENSKTRTDLFNLLLNILQDGSGDLASIDKSFAQMSVRPSK
QPNPQTPKSVGKQRATSDYFGSLALAQGHTEIVPELIVQRCLEALTYIVSSNELSSLFFL
TEHELPAGLRRHASKKGKGKEKQIPQTHYPVVLLLSLLDRPSILKTPSIVESVVTLLATV
TRPLASLKDSSKFKSEQPVPTSASTSAEVAPLTPATQPAPSDRTEESDSKPEPLTTTANA
EEKVLLTRPPVVPHTVMRFIVNVLTAGECSGRTFSQSLSLIQHLSFVPDARDIIANELRS
RAQDFGHALYTALDELAAALRESQGDVLTSSIAAKFSSPSSDQAKLLRVLKTIDYMYSPR
SATSSPASLSDAEVEKVQSIYESFKFAPLWQRLGDCLSIIEEKPELEHVATVLLPMIESL
MVVCKYVGAKSAAGNSTRLLRASASPRSPTTTRETMEDLFVTFTDAHRKVLNLMVRNNPS
LMSGSFALLVHNARVLDFDNKRNYFSQQLHRRPHSREHHTTLQLNVRRPRVFEDSFQYLQ
RKTGEQIKYGKLSVRFYDEEGVDAGGVTREWFQILARQMFDPNYALFQPCAADRLTYQPN
KASWVNPEHLSFFKFVGRIIGKAIYDGRLLDAYFARSLYRLILGKPVDYRDVEWVDPEYY
NSLCWILDNDPSALELTFNVEADEFGVTKIVDLKENGRSIPVTQESKREFVQLSAQYRLY
SSIKDQIEALLAGFYEIIPKDLISIFNEQELELLISGTPDIDVDEWRAATEYNGYTSSDP
VIVWFWRALKSFNREERAKVLSFATGTSRVPLGGFTELQGVQGVQRFSIHRAYGDTDRLP
QAHTCFNQIDLPQYSSYEMLRQQLLLAINEGGEGFGFA
Download sequence
Identical sequences 104341.JGI119743 jgi|Pospl1|119743|estExt_Genewise1.C_160108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]