SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|121649|estExt_Genewise1.C_530008 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|121649|estExt_Genewise1.C_530008
Domain Number - Region: 10-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00556
Family Ribosomal protein S14 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|121649|estExt_Genewise1.C_530008
Sequence length 56
Sequence
MTHDAVWFSRPRKYGKGSRQCRLCAHQAGLIRKYGLDLCRQCFREKSAAIGFHKTR
Download sequence
Identical sequences A0A1X6NGX4 B8P8B2
jgi|Pospl1|116095|estExt_Genewise1Plus.C_450122 jgi|Pospl1|121649|estExt_Genewise1.C_530008 XP_002471924.1.31404 XP_002472250.1.31404 104341.JGI116095 104341.JGI121649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]