SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|121823|estExt_Genewise1.C_720096 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|121823|estExt_Genewise1.C_720096
Domain Number 1 Region: 558-596
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000808
Family RING finger domain, C3HC4 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|121823|estExt_Genewise1.C_720096
Sequence length 609
Sequence
MSERTVSNLHEHALRQVQSSGDLPQTEPPARPARSSLHGSPTMNNPTGRASSGIRGAQSE
RLRMPLSPGSMSSSPIAMPEPARARPQSPPLPWDLSRVNTAAPIDARPEAGGPDSEPRSM
LYTVLELIGYSGANAKARRETLSLIWNLAFNLAQFVIIVTLLAYSSHHESPTKPGLSEWR
ACERPLGVWDSIWLIRVALGTWLSYWGYKRDRRARALQEQRERTGDIESPIHHTVGMNGR
PAPPHRPPPRPMRPGGSPGHTHDASPPTIQPPPLPHSNAYSRLSLLATFMSLAWFLTAHI
LEYTSVNSCRYSSPHLWWLTFGILCILYLMILEIFLLGLLVFVFGPVIYLLWTVILLCLG
RHPLQNPHYIKPEIGKLPKSIVDQIPLVLYIPTPPEDADNPKTPIPVPSPSYSYPPKRSS
TAAPPKRRFAFLRKMKGRKDKTKGSTGVSGSSEKDAKPHDKHKRAAANPEKLTWEDNWEP
GEYPFVRLEGNRAVCAICLLDFEEPQRTGESTEAEKKSESFAAGPDSAPAQAVQEVRVDE
VTQEDRNRLHLDDAGEGAQPLRLLPCGHVFHQTCVDPWLIDVSGRCPTCQRPVELPNGQG
KKGQRGPRT
Download sequence
Identical sequences jgi|Pospl1|121823|estExt_Genewise1.C_720096 104341.JGI121823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]