SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|123026|estExt_Genewise1.C_170019 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|123026|estExt_Genewise1.C_170019
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-31
Family Ankyrin repeat 0.00059
Further Details:      
 
Domain Number 2 Region: 572-649
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.92e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 738-785
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000053
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|123026|estExt_Genewise1.C_170019
Sequence length 788
Sequence
MPDIEDRESETALHKAALNGHLHIVTYLLPDKADVHAQDADGWTALHNACSKGYLDIVRW
LCENGGAAVEVDGVRGVDTRSKGGWTPLMNAASKGHLPVVLYLLTKQSADPFVRNNWGET
AYDVAAAVFEVWICEVLQKAEAERWQSPTMPYNPLAVHTTVPLVLYESQRLDMRLKTLAV
SGGRPRFSASGLGKRGRRAPFELRLPAPEQTTGKKEIAAWRSDVQLPLREDPWTLPRPGS
SREGTERSHFWLSDWTLDVTHPGVDAEDGWQYAHSLDDPDEEWTAEQPPQLERLLSGNGT
MTAGLGSNRSRSSSGASSSSAPRRDANPQSWARRRRWVRVMRRRLDIPPLPFLQPNGQLY
HVGPDGTMIPYEEHDDSDFGDGEGQELSAIPRSVLSSAQDYVARARYLAGTQHGDAESVN
GFNSALEARRAIAKLERATTELRQGILNDSDVERKTQAEVLMNAYSRELERRRLAAGAQG
LLLTEGEDDEIDDDDSDDEFHYPGSEPVHTPRAPSIRSSTTDYFARSGSRGPTDLTPHLS
QAPEFRVPTHEAPQKVLTPRWTPPTPHQIHAQWERDDSVSECRECKRRFNFLTRRQHCRR
CGKIFCDRCSSWRALLDPSDVVHDPSFPETPHSPTTQRVCRACYEEVTASVPNGLQSSRT
TSMERIVIDQRRLTIPSPTSGHTSSQLSDLAECPVCNSNLSDLGPAAVQEAHVRNCLEGG
SGAAPQTAKYLVYKLPAESALIGVECAICLEEFVKGSTVARLSCFCSFHNACLSSWLQRG
RSCPVHAR
Download sequence
Identical sequences 104341.JGI123026 jgi|Pospl1|123026|estExt_Genewise1.C_170019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]