SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|123159|estExt_Genewise1.C_1250013 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|123159|estExt_Genewise1.C_1250013
Domain Number 1 Region: 57-183
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.68e-18
Family FHA domain 0.0045
Further Details:      
 
Domain Number 2 Region: 220-268
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000106
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|123159|estExt_Genewise1.C_1250013
Sequence length 442
Sequence
MLRRRRSAGTLAASATPQVPVVAQARTTVGALSASAPSGGQAFRIRLVPHLASRTSLRFD
PICRDVREGDPALRIGRFTDRSGLGLAAANALGSHKLAFKSKVVSRAHAEIWVEAGGRFF
IKDTKSSSGTFLNHVRLSAAGTESSPSELRDGDLLQLGVDYQGGNEDIYKCVKIKIEMGR
EWQAHANPFNANALKQLKAIAIPHASPLEKKTAPKSALPDCCICLFGVTINQALFIAPCS
HAFHYKCIRPLLETHHPAFSCPLCRTFANLEEDVEVEIEGEVDTESIADVSAAIASVVAV
ERPNTGDGSSRERERERDAGAETEVEADTGMSRRGRRMPGNGAAPAYMLEPDVHVMAEDV
DEEMDDAAVLPPLPEGSPLLTAQEWAHDTVREASASPILVPPPAHAQGEYSEGEGEGSGE
GGSEGSTGGLVGGEAAHGKRKR
Download sequence
Identical sequences jgi|Pospl1|123159|estExt_Genewise1.C_1250013 104341.JGI123159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]