SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|124779|estExt_Genewise1.C_450037 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|124779|estExt_Genewise1.C_450037
Domain Number 1 Region: 76-124
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.7e-16
Family Transcriptional factor domain 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|124779|estExt_Genewise1.C_450037
Domain Number - Region: 8-39
Classification Level Classification E-value
Superfamily RING/U-box 0.00297
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|124779|estExt_Genewise1.C_450037
Sequence length 126
Sequence
MPRHADKIGSLLFCPDCGTLLNLPQDGEDEVTCEQCGHQEPASSYENIEIVTRSHPDAFP
SPLRQKGKTQTKVHEANEALLKVTEKCPECGHMEAYSQEAQLRSADEGSTIFYTCVKCKF
GWRVNN
Download sequence
Identical sequences A0A1X6NH53
jgi|Pospl1|124779|estExt_Genewise1.C_450037 104341.JGI124779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]