SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|124839|estExt_Genewise1.C_450148 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|124839|estExt_Genewise1.C_450148
Domain Number 1 Region: 210-496
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.32e-41
Family WD40-repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 2-54
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000203
Family U-box 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|124839|estExt_Genewise1.C_450148
Sequence length 506
Sequence
MFFCSISGEPPQDPVISQKSGHVYERRLILKYITENSTDPITGEKLEESDLITVKANPKT
AAPRPTSATSIPALLHTLQNEWDALMLETFSLKQQYNSVRQELSYALYAQDAATRVVARL
MRERDAAREALASVSATMGIAPAPSGDDVEMSEPGQETVALPEEAAKQIEETRETLSSKR
RKRKPPPGYVNPADVKTFTAKHTIPSLHSTSPSGITALAVSRSEPSQFLTGGNDKVVQLY
DRSTDKVLASLKGHTKKVMAVAFRDACSESEPTLLLSASADKIAKVWAHDSASGEYIPRA
TIRTHRGELSGLAVHPTKTLVALASADRTYSLHDLTTGNLVYRSPVGDEPFASLGVHPDG
TLVAVGTPTSTIKVFDIRSGAIAASLSPPESTPFTVKTLSFSENGYHMLAPDSLSSVAVW
DLRKPKIAHSIALGDNFKVNKVSYDYSAQLLGVAGSEGVRIFAHKTWEELVHFEEAGDVA
DLVFGEEGKEIWGASGREVRIWGLPT
Download sequence
Identical sequences 104341.JGI124839 jgi|Pospl1|124839|estExt_Genewise1.C_450148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]