SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|125010|estExt_Genewise1.C_60079 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|125010|estExt_Genewise1.C_60079
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.3e-24
Family Ubiquitin-related 0.00043
Further Details:      
 
Domain Number 2 Region: 269-326
Classification Level Classification E-value
Superfamily XPC-binding domain 0.00000000000000209
Family XPC-binding domain 0.00091
Further Details:      
 
Domain Number 3 Region: 138-192
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000486
Family UBA domain 0.0021
Further Details:      
 
Domain Number 4 Region: 322-386
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000734
Family UBA domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|125010|estExt_Genewise1.C_60079
Sequence length 388
Sequence
MKITVKTLQQKIFQIDADGSDTVVDLKQKIQENQGHAVESQKLIYSGKILPDSKTIESCE
IKEKDFLVLMVSKPKPAPAASTSAAAAPSPAPPTPAPAAVDAPVVPTTPSTPASAPQPPN
APLLTPAQATPVSTPAERAFGDSNSFLTGDALQSTIQNMMEMGFEREQVMRALRASFNNP
DRAVEYLFNGIPAHLEAAAAAPQPQAQPAAAGNAPAAPQAAAPAPPAPVSNAPQNLFQLA
QQQQQQQQQHHPGAGAGLGAGAGAGIDMANLQNHPQVQQLRELIMQNPALAQPLIQQLAA
SNPQLAQLFAQNPEALLQLLGGGDDLEGEGGLPPGAQVVHVTEEEQAAIQRLEALGFPRQ
AVIEAYFACDKNEELAANYLFDSNFEDS
Download sequence
Identical sequences 104341.JGI125010 jgi|Pospl1|125010|estExt_Genewise1.C_60079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]