SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126124|estExt_fgenesh3_pg.C_200005 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126124|estExt_fgenesh3_pg.C_200005
Domain Number 1 Region: 328-369
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000618
Family Erythroid transcription factor GATA-1 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126124|estExt_fgenesh3_pg.C_200005
Sequence length 561
Sequence
MASSPQYTYPQPPPPAPHQRLPSIKELHFDKMEHARPARPEWARPSPPNLPPQHQMSMPP
PHESPKTQYPHSPAPPKMAEQYASSNMPPPQQTGHSSMGPGPSRGEASSQNSSKRPRSGS
DASVGVSPGRSHHHPPPPPPPPPYATFPRPSGMAPPNMDPRAAMPPPPNTVDVNARQRLL
AEIHEHCRVLQDFAHHYATLQASQPNIQPSPQEMQDMSWRANIVNRLIEDLRRTQDGGGS
RDSVAAPSNATSATDETPRPPKRPWEDMSRDEAPASNGNYPEQPQSQYLDVADKTTAEAD
MEIIRSKRATSTGGNAPGQPKSKYRKRSRATPPGKCHSCNIRETPEWRRGPDGARTLCNA
CGLRRYMTSDGFVIDYAKLMRKREKGADGKTIPIDLQTLRASTQSARGTDPEQSHPAPVQ
QHHPHPNPNVVPYEQPKQQQQQQQHQQQQQQPPPAHANHHPGHPSPHPHPHGAPYQLMPV
NSGPSHPNSQAHQMMPPPPPPPVPAQQTHGETGLSVPPPPWMTSSSSSSSWSLRLSVGPP
VVHANVAPAVTCTCFAPMNGQ
Download sequence
Identical sequences jgi|Pospl1|126124|estExt_fgenesh3_pg.C_200005 104341.JGI126124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]