SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126307|estExt_fgenesh3_pg.C_480086 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126307|estExt_fgenesh3_pg.C_480086
Domain Number 1 Region: 6-67
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000254
Family Variant RING domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126307|estExt_fgenesh3_pg.C_480086
Sequence length 258
Sequence
MADSPQEGNQCRICFDGEDPELGRLIRPCLCKGSISHVHVKCLHRWRNSSANRSTFYSCT
QCGYKYHFARTRVVGIATNPVVVAAVSSLLFTILVLCCSFITTSLLPDDERETTTYLYGV
YSPVDVIQGLVRATVNTFVDDKLLDDTILSKGPPSSHIRTPGKPPGLLKRLVRRFLLGLP
VVGAGSIAHMLLSIPLPFHWVRLRTINRGRDSRDIMALLIVTVVLIGAARALYKVYRLTE
RLTQRLLLRAEDAILEVA
Download sequence
Identical sequences 104341.JGI126307 jgi|Pospl1|126307|estExt_fgenesh3_pg.C_480086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]