SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126383|estExt_fgenesh3_pg.C_800051 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126383|estExt_fgenesh3_pg.C_800051
Domain Number 1 Region: 1034-1110
Classification Level Classification E-value
Superfamily RING/U-box 0.0000177
Family ZZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126383|estExt_fgenesh3_pg.C_800051
Sequence length 1271
Sequence
MPTVPRIFRRHSHKSLKTSNIIHTESVPSLPLQRANSSATLGSDSSPPTRDAKDLHWPDA
SSSCHTPPNPHTVAGPTVSRSEDDDDREISVAIGAAYVELQQRMPDHSLPKRLSKLGQES
LITTLAAPTKAIMDESGATTAIKNAVSGFAETLPVLMKALDDIGKIHPVIQVAVIAFKAV
YTLETKRRNNDAKVIALFVEMRDMIGVLLQYGVLASSVELKDLKDEAIIGPKGVTIEARM
QGLMKQTASDIRSCGNVCDAYSKMSLLAKVLKGPLWEGTFANFVSMFSQRRDDIEFALSI
HTAGKVDGLHEKVDDLAQIVERKTDMIMEFLKNYIPPEHTDVCKQIDRRGGREAVLKNDD
ALQELVSARLEPNSSRPSNQATALARNAKHELESQLIDPAFQIQKNTQYFDRKFEMQQRQ
ILEGVGEIVNRESDRVIETVTSGPHDRILDKDLHQIWKDMGWRGSVKARHFVLALRDYEQ
ERREEKMRKEATFQIAPTFDPDAWAFDWITVKRLQAITEALDDDASGFITVTEANNFTSS
RPADWSLPQWLAYWAIGWQISATIYRDKIHEIFEKMFAMRPHLHEANVLMVDSYLSAIWT
DTCSLTTSLEPFSATPQLLERFQSYIDAEEERLRKNLEAIKYHIDDSTSLALVTGPGRIE
KYLFPLIYLLLKHVYDVFRIGRREIVNDRHNVDAYDNQWTINRAVHDRIDEMKGDRGKLT
RCDKSLMDSSASLKHQRLDLAHHFGHAYSKLYHLAYLRLEDPTSAATRKAIQAFPYKAVT
YDDTEEDKDVPTAETVLSYAYDQSQLYAGVQAMEDTATDEDRKATGNLKNILGRWTFYNY
TDTKYPFSVIWTVFIHTSNAESTQYEAFVYIPDSKVEFKLAGDIVPEADGKVTYQFRLIV
PFHGISIKYDGTLSEDGNMLSGKYSLGVLRAFFLSRMPAEVLIRRPSPMELQSDRIRALW
RFALTAVQEQVARRQVTWKFLAKRRDLRHRYMDLAIRTQLGRPLNEAETEEWRKCMGALT
PLEALICHHVMELRKRTICIHKGVYCDSCDAHDQEITGGRIVCLTCDKDGGESIDLCEDC
IGTEVDCAKRPDLAVPHLSTHDLYKLRSLVHQREFRSIVIKARNALERARTAFKDAQDVA
HERTEEGGTGEAEDRLTKIVQEDLTCIKCKERVTQPCWYCIVCEDAVFVCMKCDAEGGVS
EGKHAKAHGLVRCQEEIIEKTEVSAEEKLASMVTNKFAQVDGRFEEVETRLSRIEQLLQA
IALKMGAGQDG
Download sequence
Identical sequences 104341.JGI126383 jgi|Pospl1|126383|estExt_fgenesh3_pg.C_800051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]