SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126436|estExt_fgenesh3_pg.C_1290014 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126436|estExt_fgenesh3_pg.C_1290014
Domain Number 1 Region: 337-379
Classification Level Classification E-value
Superfamily RING/U-box 4.36e-16
Family RING finger domain, C3HC4 0.001
Further Details:      
 
Domain Number 2 Region: 172-257
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000188
Family RING finger domain, C3HC4 0.051
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|126436|estExt_fgenesh3_pg.C_1290014
Domain Number - Region: 247-325
Classification Level Classification E-value
Superfamily RING/U-box 0.00381
Family Variant RING domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126436|estExt_fgenesh3_pg.C_1290014
Sequence length 428
Sequence
MSSNDEYSDEDIEYYDEDEDMEDIDDGSASEMELDPLNDLNDPTRPQRKIFEVEYESLSQ
NDVEKLMRADIEYISSIFGVEMDTASLMLRWINWNKEKLIEKYMDNANAVLMASGITQAD
KAPERAHAGRSPSSSAHQSSIGPRRSSRRIAPEPPKSGKTKILERLTPPIEDGKFICPIC
FDDTQTETLNMTCFHKFCKSCWHAYVESKVRTEAESWISCMAEDCSLVAPDYFIEGVLKE
DKATWDRFQELLVRHFVGAMPNLKYCPYPSCTYTVSCPVSVSKTSLSSTVPIVTCGASAA
HKFCFGCHVDSDHRPVICAVAKMWLQKCRDDSETANWIKSNTKECSKCQSTIEKNGGCNH
MTCKKCKYEFCWVCMDEERPEGEETKIRTRAMTAKVYVQKRNEIVLEDTAKGFMDRRWKW
NVPVEGYD
Download sequence
Identical sequences jgi|Pospl1|126436|estExt_fgenesh3_pg.C_1290014 104341.JGI126436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]