SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126510|estExt_fgenesh3_pg.C_690038 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126510|estExt_fgenesh3_pg.C_690038
Domain Number 1 Region: 1545-1591
Classification Level Classification E-value
Superfamily RING/U-box 8.25e-17
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126510|estExt_fgenesh3_pg.C_690038
Sequence length 1600
Sequence
MNAFQRAQELVPSLHPIGLCDKPNADSTGSDHFEFHISLTRPFYLRAHQRDELKHAVKQL
AQELKNDENTRVFLTMEIGAGHAETSDSSQTFCSISALPPTLVSALNAEFSSLLSAKRIG
SFELNQVFFSDLLQLGTIMQLAEFAMRYLSSQLLILPLDVTDSVPIPAAFNYPRPWLTRI
RKVFGPRGEVFLNVWTGWYYNEGGFAISGGPDEAGIGTDLGKWPDQGSCLPELEPACPVV
VTETTVTAFRRVLQNSCVLYADILLYLVIEALFVPYLSQSTSTIARLNSIDRNGDGSEDV
LDASTHTFPAFYLHHNSQIQDAVAQTPAVQSRKYVWLGSFVMLLSRIAYGLFKHVYLLHL
PPSYYASWLSDIRGFYLSLPEDSSQSVHHDRHHAENPLHPLVSQWKAMSGISCVVLTSVV
AVLQIANTASNPLISTLGITIFAAAFTSVFFCASYTFLAFRIIKRSHIRSWIDDIQSPSA
SKWEDPALLLAAPAAWLIWSCILLYPFLLSFTWSNQLDPGGTISMRILCTMVILSGAIHL
WLAVPMFKKLGATATPAAEDDQEINRYGGSVFTVRSEVRVVAMALVADMRDIIGHNSMGQ
AVSRHRQTQSRPEPANRDSTLAEASSSRLPSSSQGTISAASKRSRRTTIRRSVLGLLPHS
QSSGSLRDNVSSGSESAQPVRKLWRRSRRWSKAPVHAELAEAGQAGAAGHGVNEMGDVSA
VSESSASVRPSTPALERSLVEEQHISQAIQHDLSNAVTQEQLAPHSSSRPPSLAQVHRDL
EEFLSGRPTSVTDEASLPLPTIEQPASGPDLTPQAPRQFPPPGTLVVVQGVVNTTDAPSA
GREPSTSTLRSSRSATPRPGSGGHLTGSLRRAASLSSATREDERLGTRNRLSSFISRSRP
SSSAGNPSGADSALHRNSAAPSDLPSSTSQETISAENASSESHDESSSDNDGPARTLSPG
SIDVLGTLLSVAAAATAASLFSPGLAFPLQNTNTANTDPGSNRPMSPTPTAGLGNLPGFG
NMAGLDQARGPAQRDGRDRIRNVWENVRERLGLNSRSPFVSGPNSSTLEDGGDAGENRMR
PGELMLAEMARALNIGLGLNDSTTAPAARSTDQDTADGASASATDDATQSAGVDNADRHL
PPEDSFERFLLNLQADLRTALLQDGMGSQSERDNIPLNTASAPTHVDGPEHVAGPSDIAR
ENEQLADAQQATVLDTESHDDDGPPPLADVSDSDSEDDDDGDDDNDDLEDEDTPRAARTP
TPMPGAFPFGGDHRHDAQGERRPPGVNLWRLYRFQPIPASQTHGHAASTSSQDSSTPIIG
VTSSSSPETAGTGTSPPSSSPSPSSPESSPDASGTTSSTADTNVNVVVPVIVVGLQSVDM
TRNPDHIPPSHEHPHPSDEGRPSDPNLGLSDDWRRVGGASYGDSQSGTQPRGRTWQSRAA
NALRTLRPGRRGGSHGTRTNDSTGARTFLIYVIGGYYPPNHHMVTGSDSLDSYDALWELA
ELLGQVKPPVASREDIDNSGLQIIKAADLTQYEREGRVSSNCTERCLICLDDYAPEGNVR
LMSCKHAFHKDCVDKWLQVGRNNCPACRTKGVSTVGEPSV
Download sequence
Identical sequences 104341.JGI126510 jgi|Pospl1|126510|estExt_fgenesh3_pg.C_690038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]