SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126585|estExt_fgenesh3_pg.C_110028 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126585|estExt_fgenesh3_pg.C_110028
Domain Number 1 Region: 281-358
Classification Level Classification E-value
Superfamily RING/U-box 0.0000373
Family RING finger domain, C3HC4 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126585|estExt_fgenesh3_pg.C_110028
Sequence length 651
Sequence
MDFPSQSIHFGRVGHKLAAGFGSGADTPTSGRWATEDREVDTWITYYIWLPSTTLRSLRG
EATLAAVLDADWLRTMSGDADVLSELLIARILEEEMLALTHAQEAEKIQVDLMIDESDLL
AGKGSGKHKAVAQDPISDSDGDLVLKMVIKELRMSSDATLAQALQHSDDVTIIASQQHAQ
RLAAAEKKLLLDAEFARRLQAVDDNANADIDTAEYMDAETVLGRETIEQLLASDPNDKGK
KSVTGKGKGKSPVSLYNIKQSSQDDETVNKDVDVPSVAYPICGICMEPFQATHSPLASSA
SANSSARLKFGLRLPCPGVHAYCMGCLGDYIRSKLDPDGDETTSMNRVVFPIRCPECPLI
EWADGIPDEVATRILPEKNMVLWHHQKLLDSMPRYYCPNPRCSAVVWHESPALAQMPELL
SLWDVRRQRCTRNPACDLWDEEMLLEERERERDHRQDRVARMFAPREESPPPYEAPPVPP
VGHEEPDDHGTDGGDDLEYWMDPEPGNFDWYDDTGISDGTDDVGTFDWMDDPNVFCTRHW
FTTQMIQTLTCGYCDAKLNSFADLRYHLGHVRRHDVFACCGRFFKREKDLERHLDAEPKR
FGRHVHTRELRGRYRVSASDSSDVADAESATSDLIKTSVFQGMHSAKTHEL
Download sequence
Identical sequences jgi|Pospl1|126585|estExt_fgenesh3_pg.C_110028 104341.JGI126585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]