SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126598|estExt_fgenesh3_pg.C_110061 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126598|estExt_fgenesh3_pg.C_110061
Domain Number 1 Region: 64-197
Classification Level Classification E-value
Superfamily TPR-like 3.87e-22
Family Tetratricopeptide repeat (TPR) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126598|estExt_fgenesh3_pg.C_110061
Sequence length 227
Sequence
MLSNIGKACLRKCSTERFICLANVQARTIYTRLATSGHPRQTRVGWATSTTDHSSTVDPA
EVEAMQCLEEGTQKLEEGDVNSAKELYKRSVDIKRTASSLFNLGVTHYHLKEYDEAIAAW
KESIALQPSSADAHTNLASAYIISPVSRPDLALHHLSIASSLSPEDPEIAFNYAAVLEAC
GRLEDALAQYKRSKKFGVERAAVHIRNVSAKILGKQLTEVEQASDEK
Download sequence
Identical sequences jgi|Pospl1|126598|estExt_fgenesh3_pg.C_110061 104341.JGI126598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]