SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127048|estExt_fgenesh3_pg.C_1100009 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|127048|estExt_fgenesh3_pg.C_1100009
Domain Number 1 Region: 162-233
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000158
Family Canonical RBD 0.0065
Further Details:      
 
Domain Number 2 Region: 27-82
Classification Level Classification E-value
Superfamily RING/U-box 0.0000113
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127048|estExt_fgenesh3_pg.C_1100009
Sequence length 485
Sequence
MSEPVLYYETPAFCSSPKSKRRVEDAVFVCSVCSAGGGPLAILEPCEHPLCSACLTSALN
IVGEKDMECAVCKAKVDNFQLRKPPQGSFGNGLHQTAPHTSAGGRSHGDLRVLDDDGGLL
PSAFDGGALRGAGSGEELEDFMDRAQGASTPVAAARGTFDDEEGHLERPVLRIDNVPWDI
TPPLIAQWLGYPIERVHVLLDRKGKTLSHAYVEMCGTAAAKLALRSAQNSVLGRGKRARG
VTVTKSSQEELMRALFPSWQGNFDNSRPSLSGLDNERVISTLQRGLISEAELNSLLHLIR
SPDSHFLKVPSLPFHSLISLLTKFPADDDSRVFWSGTLRDSLYDITYTAVNILLERIEEN
PFSEWAPLISDVVRAALECQAFTSEQMSKLSDILEAALHKVSGAPKHPSSPPLRPVEEEL
QLQPQLQLQPQPEPQNEVKGRSAPGRRAYGDLAIEFGVEPHLIEALARRLSDLREVGKSD
SVFSV
Download sequence
Identical sequences jgi|Pospl1|127048|estExt_fgenesh3_pg.C_1100009 104341.JGI127048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]