SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127053|estExt_fgenesh3_pg.C_1100032 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|127053|estExt_fgenesh3_pg.C_1100032
Domain Number 1 Region: 211-265
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000848
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 2 Region: 68-103
Classification Level Classification E-value
Superfamily RING/U-box 0.0000864
Family RING finger domain, C3HC4 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127053|estExt_fgenesh3_pg.C_1100032
Sequence length 508
Sequence
MLSRFLSCSLMLVPPGPVGAALFKHRAQTTVNNGHQIDGHDNTHGTNVSASLSGQRQGSV
ATRRRATGHNCVICTDPIYNDEVRAPCGDYYDRECIVALFEAAVRDESLFPPRCCRQHIP
LVLVHRFLSAALVKLFHEKTKEFGTLKRIYCANSSCSRFLGAQVEGAFSRWLWPTYKCPA
PRCGTSTCTNCKSKVVGRRHHCSTDADRAVLALGETQGWARCPGCETMIELNHGCFHMTC
RCKTEFCYVCQARWKTCTCPQWDERRLMVAAEARADAQLRRREPPPRPQPRAPVVQQPRR
PAAPATPPLPPQPQPRQAVARAAQELAGAANRTGLAVLNTTRLAAEPLAALRLTASRPAS
VAAPSTAGGREIHAASQTTPSVRSSVLSDVRLPVGTPTRADVPPARRNEVFRAPEPSGSA
LRAPATTVDQQPEQARSQARLDVSPRSPSAAPRAPVASGSQNQARSTQRDSLAPAVFVFN
LCLAAVQWLRDACLQPLPKESTVIVLGM
Download sequence
Identical sequences jgi|Pospl1|127053|estExt_fgenesh3_pg.C_1100032 104341.JGI127053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]