SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127106|estExt_fgenesh3_pg.C_1860024 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|127106|estExt_fgenesh3_pg.C_1860024
Domain Number - Region: 86-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00204
Family LIM domain 0.023
Further Details:      
 
Domain Number - Region: 123-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00903
Family LIM domain 0.027
Further Details:      
 
Domain Number - Region: 37-71
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0635
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127106|estExt_fgenesh3_pg.C_1860024
Sequence length 693
Sequence
MLAALQPSPIPMLDASPEVSAGNAAGLDPSLLTENGFCPGCKKSVVDENGGVVVAFGQSF
FHVDCFKCAKCGNQVTADTNLLLLSDGSPICANCSYSCNVCKLPILDEAIMTGDDSYHAH
CFKCKVCKNRIDELVFAKTSQGIYCMNCHNQRVARSRRHAQRQREKEQERQRERERAAAA
LTAPGTTGADTSSRSRDEVPRSQLPQRSSTSQSPMGVQSSQTSPSSVPSSNGQRSSLSSV
NSHGRRDQTDGAASPASTTTRSPPTALPLSKRPSTAAAAEPARSSTYDSSVQSTLGRSVV
PSGSRADSLAVPSMSDGSDRSLHSRKSFDGGVRPPLRTTPSANSLSTTASSSSYGLGIPN
GETSRKDKRRSINPVMQHGSSSTVSSPANVNPSSFLPSPSSAHDRRPSSPFYDYFTAGHT
MSPPTHTESADFTPFSRMGASSTRPSTPLSTRGSIEHGGQRERTYSGPTPYRSLEQTPRG
PSRSGPGLPSRPNARPDHLRESPSADGLRRGSEGRRPPSLILPAGPTVRPQRSFDDRARA
SPPPSIRPIRNSKSSGTELELPSRPSSIPTPTSPSHRVDVPHGIESGTDTEAESDEHRMT
TEPESMLDLPPALPPKDSPSGKAGMRPPLLRLDTADIRRDTSDARRLDSEEPTDAPGSWP
VEGWRLSELVSLLVYEVECVRMARRVLVRLSVC
Download sequence
Identical sequences 104341.JGI127106 jgi|Pospl1|127106|estExt_fgenesh3_pg.C_1860024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]