SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127556|estExt_fgenesh3_pg.C_2120010 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|127556|estExt_fgenesh3_pg.C_2120010
Domain Number 1 Region: 6-44
Classification Level Classification E-value
Superfamily UBA-like 0.000000595
Family UBA domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127556|estExt_fgenesh3_pg.C_2120010
Sequence length 485
Sequence
MSDKDVLLQMGFDPARVEWAIKATGGRGLQPAMDHILENEGKPVPDLSSVSSSSASSGPG
AESTGQAIDENDEDMEALKAVYGSAGAGAAAVADVEAKLAEVTASCDRLMETLLTVSDQR
AQIQRIQDVHVASALGIALRKLNASYGRRATDLATARAKVDELTEELEEAWKVAEELAQE
MDDLDNFEFPYPDEQFGDTSAVIGETSTERSVQLAEVIEITGKAVATKAAYANVSTPQSQ
VADRASRVSAARRRSVRASKASLRLPRSPKSPPPSAFEQSATLRRARSRSKSRRRPSVVT
DSEAPQIPTIQVDTATYKGGSFLELTETRPTSPATTASPEAHPPLPQLIVMSPTSKRETL
DVPSLSPHMALPSPAFDRTIIPPLTTSGAKDDAWHRTEHERRASARRVQSWQPRSRTDPL
PQTLLAALRRANSDHRRPSSSWLVQENARPPKAKRYSVRVAKDPLENVLDTKGTASMYEA
AGNEA
Download sequence
Identical sequences jgi|Pospl1|127556|estExt_fgenesh3_pg.C_2120010 104341.JGI127556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]