SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127575|estExt_fgenesh3_pg.C_850024 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|127575|estExt_fgenesh3_pg.C_850024
Domain Number 1 Region: 308-362
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000003
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 2 Region: 171-222
Classification Level Classification E-value
Superfamily RING/U-box 0.00000629
Family RING finger domain, C3HC4 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127575|estExt_fgenesh3_pg.C_850024
Sequence length 477
Sequence
MPEAWGASEPPSFGILNAPDAELTLKDVDDVAAGRKGKGRATAEISDEELAFQLFAEEAN
SLLDFTKDAAFARSINYAMQTDIATVEEILREEITAREDHELAVALSEGRSRAPPSRAAL
PAPSQASVPSGSAQTSGLYSARSSQVESSSKSTLSQALVVAKRHGIASKQRTFSDEVCVF
CRDEIKGIVFRAPCGHCWDIDCLVNLFRAASTDESLFPPRCCQKPFAVNDIKPYLGEELS
AVFDKKSIEFSTADRIYCHRPTCSSFLGPATAKAIIHICRECYSQTCGLCKQEAHPSRLC
PSDDAPVLALAEEAGWKRCPGCRALVELVYGCYHMTCRCRKQFCYVCTATWKNCTCPQWD
ENRLLVAAQRQVQRERPAGPPLAPQQVRWRVAEVAERLRVDHDCQHVWKYNQGAGQCENC
FHHLGVFLLQCDQHMWACYPIFAPMVVVRCSFRPVSWVSPLSWSSVRSYFFQSSFAI
Download sequence
Identical sequences jgi|Pospl1|127575|estExt_fgenesh3_pg.C_850024 104341.JGI127575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]