SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127590|estExt_fgenesh3_pg.C_850053 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|127590|estExt_fgenesh3_pg.C_850053
Domain Number 1 Region: 38-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.81e-34
Family G proteins 0.0022
Further Details:      
 
Domain Number 2 Region: 411-516,566-648
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.00000000000000756
Family YhfI-like 0.067
Further Details:      
 
Domain Number 3 Region: 1037-1201,1347-1383,1410-1551
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000000000746
Family DPP6 N-terminal domain-like 0.025
Further Details:      
 
Domain Number 4 Region: 2212-2288
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000435
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|127590|estExt_fgenesh3_pg.C_850053
Domain Number - Region: 206-284
Classification Level Classification E-value
Superfamily TGS-like 0.015
Family G domain-linked domain 0.029
Further Details:      
 
Domain Number - Region: 1515-1628
Classification Level Classification E-value
Superfamily Nucleoporin domain 0.0497
Family Nucleoporin domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127590|estExt_fgenesh3_pg.C_850053
Sequence length 2337
Sequence
MTDEMARTQKNKARPASTTYHTFEVDGAPSRRRNIIWSTLLSKCTQTVSETAAYEFTTLT
AIPGVIDYQGARIQLLDLPGIVEGASQGRGRGRQVVSTAKTADLILIMLDATKSDEQRRL
LEIELDAVGIRLNKKKPDVVFKRKTTGGITTDEFIDVLIGLTILDVYNKIDAISLEQMDK
LAHDEHTIVISCEMGLNLDHLIERMWDELGLVKVYTKKRGAHPDLTDPICLRRGANIEAR
RVQRYSPVIGNAFPIWARLGKSSKFSPHAQKVGLSHMVQDEDVVSNEIAGAAEGPNRLIK
IRTAQDQGSDPTWRRRHRKRPLSRRIALTKLDRYLHDDCLTAPPSSKPCRTCLSTLTPEG
KKNIRVIRCTAALGLHIALTAEDVHSAIPRPSSNSVAGTLRMYVGKSFQPAAVEWFPKHG
LRRIDAVLITHAHADVLVPAMNGLDDLRDVYVSMSTFKEVQRAFPYLVSKQYASGGGDVP
EFKWHIIEDRVPFEIGDTGVQITPFAVHHGRIFTPAPPVGDISISPFSLSPASTNASTPD
VPGSPVHAATIPTESAIKHVRPYLCFGFVIQDAITYLSDVSHIPEDVWAMFESKPVVPPV
FVLDCLRVPTHPSHLSVTEAMSVARRMKADKTYLLGFSHELSHDDYVAIGEAAGGTGLSK
RGQELISQHSLQSVHEGQPIWIRPAFDGLRVSVTQDGQNWARIEFDEAAVEGHVGRRLLQ
ERESFQCLGWLSKEGSSASLRSYIPKPCPLPPPTPPTIQLTTYHNHALSNFNCCESPPGS
FAAMRFYSQSFLYDDPWSIVSYAFFMRYPNPFASHVLSCDVVSRNISPTGTLVTTRLILK
SGAMPRWAPKGMVSRAESWVIEESEVDPVGRVVRCTTKNLDHVKVMRVEERVILEQTSDD
KTLQNTEARIVSGFGWGLTKRIESHGLARFKANIQRSRQGLFTILELIRQSRAQTMTMGV
PSLYTPSQRFTSGSSASQTASEASGSSDNEQKPRGTWLNPNRDVLSFSAPLIARRFGGLA
AARQLSTAPALPVPGEHVICLSPSPRRSLFCTLTKGGLSAWRVRPSAIVAHLSRTPASLV
EHGENASMSWSPNGRRIVIQTTRSYLVLVTVEFNPDEILYQSPSLAPSAQRHFLSGPGEA
LPLHAIGLHLEGVVRLEGTLLSVSPHNDCILFSTQGPPSVQRIPWPGTPDDRDHYATWLL
NEDEFPWLEDADVTVSRIIYSRSTGFEAWITSDGRAYLVQLYEDDNEPYRPSESSVDDQA
YQGTCIHNVDPPRWVQKRRRQDPCELKAGEYSYVEPRRAMTTAINARFSVIATGTYGGVV
EVANFPTEDNPLPKAEILQIPSMYTRDGTGLVRAMEWSSDGYVLAVGWEKGWAVWSVGGR
CLAWGFGVEYEVDEERYQDSFMYGVTDLFWGPGNFELFVLAATSPNSQYPSSLLRDARLM
SAEADGQLFVIPFAKSASTGQHSPDNTQYAFLQMDDRVLVYRGADQPDMSVINPESDVWQ
HIKIPQAYLSANWPIRYSALSADGRLIAIAGRRGLVHYSTTSGRWKMFSDDLQEQAFVVK
GGLLWFHHVLIAAVDVANTSQIRLYSRDMELSNQNVLHREILSSPVIILSLVDNSLLVYT
ADNTLYHYLIIPTAETIKLHLCGSISFSGVIAAPGAVRLLSWMIPSAQKQLGDPIEDLAV
ATVLMIVGGKLVLLKPRRSGDAEVKYDMQILADRIEFCWLHLRGIGTLENSLWGYDGQGI
RLWLNALNIEGPAAPATADAVALPQSVKESVNIPLEFYPLSVLMDKGIIIGVEYEAATRA
SLSFTMFRQVTSSHLFLNHVLLFHLENRQLKEAILFSSHYQHLVFFAHALEMMLHTVVEA
DASANHDRRSGEETARNPELLPDTVDFLDHFDVALDVVVGCARKIEMTRWPRLFDIVGNP
KQLFELCLSSNRLKTAGSFLLVLHNLDQLDADGLNGDAARLLKSAITAQDWQLCREILRF
LHFADETGAALRGALTEAQIIPLLNGAWLINIGKGVFDLGHCPAVSPAHAEPQPEDEDED
KFDDLPDPFAGIDWNTVAGLDDGHTATPRPSNSACQPPNGEIEGVAPPAQPASTHSSSHY
EFDEVDGTLLEEVDAIEREQMRLVPHTSPRMYRQSGILSLPPILPLPPPPPILHPWDLKL
CRALDSEIPTTPRKRTRRIDSSPVDVSPRKKGKKGKDKEDVDPFAHSRQVLAEFEDELSC
AIAIMISLNVGSAAAHIANPCGHTICGECGFDWIARNKRAPTCAICRTKLIRAAPLIPNI
AMDNTIAKHVGALAASGCVDWQPTGAKHKEWVQRRECVLDRLSEVEARRREAGSGAA
Download sequence
Identical sequences 104341.JGI127590 jgi|Pospl1|127590|estExt_fgenesh3_pg.C_850053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]