SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127885|estExt_fgenesh3_pg.C_1350022 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|127885|estExt_fgenesh3_pg.C_1350022
Domain Number - Region: 850-927
Classification Level Classification E-value
Superfamily RING/U-box 0.000118
Family ZZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127885|estExt_fgenesh3_pg.C_1350022
Sequence length 1096
Sequence
MAESGATTAIKNAVGGFAETLPVLMKALDDIGKIHPVIQGSILAHETSGGLKNVKDEAVT
APDGVTIEARLQGLMKQTAGDIQSCGNVCDAYSKMSLLAKVLKGPLWEGTFASFVSKFSQ
RRDDIEFALSIHIAGKVDGLHEKVDDLAQIVERKTDMIIEFLKNYIPPEHKEVYEQIDRR
GGREAVLKNDDALQALVSAELETNLSRPSNQATALARNMKHELESQLIDPTFQIQKNNQS
FDRKFEMQQRQILEGVGEIVHRESDRVIESVTSGPHDRILDKDLHQIWKDMGWRGSVKAR
HFVLALRDYEQERREEKMRKEATFQVAPTFDPDAWAFDWITVKRLQAITEALDDDASGFI
TVTEANNFTSSRPADWSLPQWLAYWAIGWQISATIYRDKIHEIFEKMFAIRPHLHEANVL
MVDSYLSDIWAKLLERFQSYIDAEEERLKKNLETIKYHVDDSTSLALVTGPGRIEKYLFP
LIYLLLKHDYAVFCIGRKEIVNERHNIDASDSQWTINRAVGDRIDDMKGDGRKLIKCDKS
LISSSASLKHQRLNLAHHFEHAYSKMYHLIYLAMEDPSSPVPLKTIQTFPYKAVTYDDTE
KDKDAPTAETVLFYAYDQSQLSVGVEAMEDTATDEDRKATGHLKNILGHWTGYNYTDTRY
PFSVPFTVFFHTLNAESTQYEALVHVPDSQVEFKVAGDIVTEADSKVTYQFRFIIPVHGM
TVDYDGTLNEDGSMLSGRWGPDGTRPASFFFSRMPEEVLICRPSPMELQTNRIRALWRFA
LTAVQEQVARRRFNWKFLAKRRDVRHRYVDLELRTQLGRPLNEAEDEERRKCLGLLSPLD
ALIAHHLMALRKRTICIHENIACDSCEDDDRDIIDGRIVCLTCGKDGGESVDLCENCIGA
EVDCTKRPDLAAPHLPTHDLYKLRSLVHHREFRQIASMARDALERARTAFKDAQDVAHGQ
TEEGGTGETEDRLTKIVQEDLTCVKCKERVTQPCWYCIVCEDAVFVCMKCDAGGGVSEGK
HAKTHGLVRCQEEIVETEVPAEEKLESMVTNKFAKVDGRLDEMDTRLRQVDERLSRMEQL
LQAIALKMGAGQDGSS
Download sequence
Identical sequences jgi|Pospl1|127885|estExt_fgenesh3_pg.C_1350022 104341.JGI127885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]