SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|128548|estExt_fgenesh3_pg.C_1910007 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|128548|estExt_fgenesh3_pg.C_1910007
Domain Number 1 Region: 15-119
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.05e-20
Family FHA domain 0.0029
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|128548|estExt_fgenesh3_pg.C_1910007
Domain Number - Region: 482-643
Classification Level Classification E-value
Superfamily Tropomyosin 0.0017
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 217-346
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.00275
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|128548|estExt_fgenesh3_pg.C_1910007
Sequence length 809
Sequence
MPTPFAAAAHGPVPLPALYLYPLNDSFVPKHISLINGQRVKIGRQTNAKTVPAERNGYFD
SKVLSRQHAEVWEEAAKIFIKDVKSSNGTFINGERLSPEGVESEPFELKSDDIVEFGIDI
VGEDNKTIIHHKVAARVVCVFTEQEAQAAARAEAQAGPAAYGVGAGGGAPPAAGAFSFAP
GQPPNAPGQQRRPSLQQGLIGLGDRGGNMRAPGKSGLTFDHILSRLQGELQKSRDTGAEL
HSLTSAMNEIHDTLGGNLPPNLPPHPSNLPPVMPPQSQQQQQESEQQQAPAAPSPSDSGL
ALSELQSQLRETQMSLASHVDKIRSLETMLAEHEAIKREVGSLRELMEERKREMDTSRGR
SGSPSGRHHQYGRDDNMAHDQHYMSDDDDDARSVSTIVPHELDRVDEEDEEQLAAEEEEE
QRRRRRDELGRPRTPEPTGMGMSDDDYDHDHDHSRYEPQQRTRSPSPPPAAPPVPIPAAV
PDNISERLTTLSKQLESALELSRSLEAQHSVAQSTISLLESKVASLESLVHDTRSQVQVQ
TEATEQLAEAMRSEQLPDSAAQEAEQRTRESLTEMVNEWKKNVEGRWSNVQEEWTEERER
LRRAKDEWETRIRVVEDGVGSNVSKVESMLGTLAALPAQQHSFLNGNGKLTHSGGLVTPP
SPRSLSAESTRPRQRRKRSSSSRGRSRSRSASMTAGAEVGSSASSISGDATESHPLGRRR
LPWTADDSSISDTESHAASDRATAAGEDEPTRNLKGMPFPITPESSVLNHPLSSSDDASG
TATDSQTRPPPKDLVCSFSAWSPGRYYGG
Download sequence
Identical sequences jgi|Pospl1|128548|estExt_fgenesh3_pg.C_1910007 104341.JGI128548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]