SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|128727|estExt_fgenesh3_pg.C_190047 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|128727|estExt_fgenesh3_pg.C_190047
Domain Number 1 Region: 11-108
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.27e-23
Family PARP-type zinc finger 0.0057
Further Details:      
 
Domain Number 2 Region: 147-239
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-20
Family PARP-type zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|128727|estExt_fgenesh3_pg.C_190047
Sequence length 401
Sequence
MSDQEGDKKSGYRLEYAASNRSVCKGTKITKGELRLGSVVDFRGNTTMVWRHWGCTTPRI
IQNMKKSFEEADELDGFEDLKDEDQDKIRKAWEEEKVADEDIPETARKPEGEEGEEEEED
DKPKKKKAAGKAAKKEDADEGDKKGVFKLEYASSGRAKCKVCQENIGKDFFRIGNEVDFR
GNKSFQWKHWGCIDAKTVTSLKTSYGEPSEIEGWGELKEGEQDKVRRAWDEGAVPEEDQG
AGEAVDTGKKAPARRRKKAEDADDAEPKKRGRKPKKVEDEDEDAEEEKPKRKRAPAKAKN
GAGEKSKAAPKKRASRKKKSSDEEDEASAEDFEDELAAVGDDFEDDELEEEEAPPKKRQR
APTSKASAKASKPPSKKASKPVSRKKKQQEEIPEESEVEED
Download sequence
Identical sequences 104341.JGI128727 jgi|Pospl1|128727|estExt_fgenesh3_pg.C_190047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]