SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|128733|estExt_fgenesh3_pg.C_190061 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|128733|estExt_fgenesh3_pg.C_190061
Domain Number 1 Region: 585-696,868-930,1049-1110,1174-1510,1812-1878
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000105
Family RPA1889-like 0.052
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|128733|estExt_fgenesh3_pg.C_190061
Domain Number - Region: 29-68,187-250
Classification Level Classification E-value
Superfamily TPR-like 0.00146
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Domain Number - Region: 2236-2276
Classification Level Classification E-value
Superfamily RING/U-box 0.053
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|128733|estExt_fgenesh3_pg.C_190061
Sequence length 2847
Sequence
MRAGHVDEAAGILGLFTKKDAVSPGADLEDMQSLLYLTEEAAAHLRKGNLGMALKKYTAI
QKIFDEWDDDQFDFHGYSLRKFTINVYLDLITWEDHLRSHPDYISSAIAASQIYVRLHDD
PSLATRGSSTTNMTDAEKKAKKKAKKAEKKSQEESKKASTSANEDKGLELGPAKDDDPDG
TKLLQVQDLLERAAKWLAPLGTLAKGNLDAWIVIYDVAVRRKKYLQAVKALNSAHALDAD
HPELHVRKAHFKLALSSAQEQPAELVGPVVTAALTNLLPDELSLELFNSQYLQRHSTDAR
AILASAKVSRLLNAPKDEVESAVFAALNPDVQLDIKASVYFRLLFKGTVLTDTSLQTAQN
VLVFLNDIGSSRADEFRQACDGKFALSTVFKLPSETAGLRWSALPPDEPMSAGEADKAET
TRVTQECERCHTPDDDRTQDFNDFKDDCIDHFHPIHVVRERVDVWRPLDLKMRRRWGSAV
VIPCTYRARDAETGRLDQRYLGRWSGKSSASSGTRKKHARKAAAGGPVEEPVLPKEKRAK
GKDKKNQEPRKKVYIPPVKPVPVQPDPLDTLGIAQKVPPELLVVLKRLAKKDSITKRRAL
EDLQAGWVDNVRREGESSSLLPDLLESIPVWLHHVPALFLHPSRRIRLLAVGLHSSLLHL
PRVLTDALLYAITDGVSSDNAEYIIGAWCTAAHDVDRQVSLLARQSWVRSVSLSSAVPEQ
KLLLEGALLQQLWGYTHRTLLDPSGVYAYVNPPQAVAHPPSVHQGRRGSGRAPPTPVRKD
RDEEASARARTEEEEENELDRNARLRIGACGAAEWIINALAGSESTAKALTDEFLAPFAN
PALWSALCHAQTPPFVQIDGPGFGFAQPGVRRAAWSLLQTMLRSCKAGIQGLVPVLSGAV
LRSAWVEPDVNVRATMWQPLLTFLKDHSSAWEVEAISEQEQDADDSNAESDGSEDEEEAT
PRKAIPKESGTIGPSQAYREFLQFLELGCGGVPLQGYPTVLIILATIPPTVISSSSPSPL
QDFFTSFWAALDGRALSSLDRKAASAAFLSSLLECLVLMVRRLVAASPEVAKSLAGTSLQ
AGDGTDVQREAAQSLLREQFSRAWEELSSKRLKIEGETAGSIIAKNLTTLCRFDSGKWRK
SRGAFVASSNNSVLPGDLFQAAWDALASAIRTQVHAPDTPVSPLVSHVLQVLQRQFEQGS
VPAAAAQALTRETVQDAIQQWEKLLESEHAPEVGRVEALVGIFDVFGAFIFGQPDLAKSV
DETIRQHTIRLLTTSPRMFLVYLKHRGNRQLCFQLWQDILRAVASHPDDVGVILSPFLDA
AEGSLLPDYLKPESGSLDDLAGDLLAEVLSGSPMIAEVTIIRRLLRSPDYFISQPCFQSL
LASLISNFTLHFAHALRDETVSTDDFNTSLDLIQSLANAHPAILFSEENAKSLFPDVFLF
SHLLPRFTPVSEQQQNIARDLWRSWLSNSPYEVKSNTLAILRQRIKELLLDCDVRPTAEQ
IVRMVLENLSGLDMDSSLETLPSRADLDDMLIRLPYTPADPSLAVVDPLVPPPSLCEPVP
AVSGKYDQAGFSVYARAVYALLLRFLKDRHAAKTNVWALRHLLALSLYAEEILQSLAVQS
PVFSGQIPRSSLVDIQARVSQIAAYLLSSGHEDGWHNTVVGTIMASKGSDMLDGVGQVVY
EQIQHAKLKDTPRESRIIHVILQHVLSFVTKPEAEQWLQLARRLEKQAPHMSLAIIYSIT
QYAPEPPMLDRYRNELAAGMLGVPPSKANTEGLWLLRRLAAVAPDPESDIIFLPQLRAVN
LMKVCQQWIASDEDLDEEVESEMTLVFFHLAPILQNVQGVHWDLIFDVMENNLENASLKE
ASTLVNLSRTLRLLIAVENLTSTNKSLRAVWQERETTCLSLVRDLAATKLGLARVPHGRE
DVAKGTSQVIYMCHVITDTSADVQRMAYQCLHEAAKKYTEHIVIEAAVESEDPVKPELPV
ELLDILQRSIYSDDGMEATSQETSGYFLAWMLALDLFANASLKVKSGYIDQLRELGLVYD
NLLPSIFTILGLYDGLPKAFKLDIWAIDEYYLDFYSPGSPLSLRLLAAHLYYRALLVVPS
LIRGWLSDCRDRQLLGTITAYTAAHFSPAIVRSVLATLRDRGAAPDLADENFSVRVAGAV
GEVTAAYLLDDHKLELVVRLPQDYPLHGFEVRDRKPVGVAEERWRAWVLGVQQILSFRSG
SIVDGLAFFKKNITSYFEGLAECAICYSFISAMDGSLPRKPCKTCKNRFHAGCLYKAPGA
SGAAFGRGSACLRAGHGRERDAAVQRPFGPFCVRRGVACCTGAAAAAAAAAGPFMVHGSW
FMEYELWLMARVWPRVHARRVHEPSPLWVGHRHASSKSNSNSKFKLEFETQAQDSNAVPH
GLLDLDGTRVHALFLVLGRALAHGCHASRHSPRAELGPAHLRTCTVMSRSRARDTEWRSL
SAVSHARFAPSSFWRLAHRACAELRHPGRAGYSWRLRADDSAAGGMAWRGVLRAGVCFLL
AAHSSRAGLRTHLAGGARAAKPLLVLILVLVLLVALALELVEAEVELAREEDDAGVLLVE
ELGGGDGRDDAEVGGVDGGGVGEAELGAEDVREDEHVGGGERGGDLALWRELGCGAGGAR
TRWADWGAGTLWRMRVRVLRRAGRRTLDETDVALDLCEGELSRGGLGWLVRGRLHGEEEG
RVRMRRGGGRGDGGHDGLYARGCGRGVCLGEDRGGGGGGSGTAGCGGFIGSHGQQKKEKE
KERARLWPCTGRGPRSDAVAISVRAGSAPGPSSCADEPLGQRGHALASAFSASPRVLAVP
TPVLHSFLSPFRLPPRAAEHPSLRCCV
Download sequence
Identical sequences 104341.JGI128733 jgi|Pospl1|128733|estExt_fgenesh3_pg.C_190061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]