SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|128803|estExt_fgenesh3_pg.C_1390010 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|128803|estExt_fgenesh3_pg.C_1390010
Domain Number 1 Region: 29-130
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000021
Family FHA domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|128803|estExt_fgenesh3_pg.C_1390010
Sequence length 619
Sequence
MDSASPAEPSRVGNIHGISLHIESEDERSSQVLTFDKSQSSAITIGRRSSHTRRSGSLRE
LDCALFRCPVVSRKHAKITFTKYGNAYITDLKSHHGTYILRPGDTLSKPIKAETPTVLAD
GDIVTFGKIVSNDDTIVHPIAARVSLLYGPGPAAATPTHTTPNANEAEEPPRGTSGRYGI
YVSSDESEESSDGGSDVEEIPPPSPPAAARMHRYNLPTFTRPSDCTARMQLLRQVLPAIQ
PACIVDLRSVSPDPAPPALPPLESASPALVPALVQQDGQTGGEAARDDGPNPELSIVDRR
DLLRDLPDLSVPPPMYSFPWPLAFSFDANAGACSHAIEGTDFMHDCDSELANASESPATQ
VSENVSSGKAQDGEEDDTASSEGRSTTPEEQPTMVLTELEAQVNLASNDISTLQMQRRSD
ESRFEEHVRVTKARLAELDEHMQELNGRVTKHVAANDVIMAEATSRVDDLRADINRVHTE
LTDKLASEERASANHAVELNNVDAMRTMMEDMRSLKNAVETQLARDIEIIKVAHAQTQAA
LQALTAASAQQAETSGTRKRKRLEMNNTEADNEPGGESRVAAPLPKRRRTAGRFVKQVVQ
TTTVAAVGAVFAVAALAFV
Download sequence
Identical sequences jgi|Pospl1|128803|estExt_fgenesh3_pg.C_1390010 104341.JGI128803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]