SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|128977|estExt_fgenesh3_pg.C_1830024 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|128977|estExt_fgenesh3_pg.C_1830024
Domain Number 1 Region: 1982-2107
Classification Level Classification E-value
Superfamily Sec7 domain 3.14e-41
Family Sec7 domain 0.00037
Further Details:      
 
Domain Number 2 Region: 1177-1231
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.61e-19
Family Erythroid transcription factor GATA-1 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|128977|estExt_fgenesh3_pg.C_1830024
Sequence length 2447
Sequence
MTVDNHDLKTTDLTEPTDLGEGRLRNASAGSRWRTKKATRRSLNMQSTHETLDGCVVRQA
DGLGHGEWLETMTQERGHITSSRLRIACASSASNEKEHGPPVAVCIEISLTVGRVAAQLS
QNLTALWAEASITKLRRDRGTAMGYAVFSLQSHLKSAANGEWRWRVAFHHNQGLDSEESH
REQSERSREQHRVTRSARHQDRSRKQPALTGVIEWVGRPLDPQFEGECSPMELPTSSLRG
FHEDINRPWSPERATVNTSLSPLSVSSHSALELSPRSSSSVSNSSHSSPWLQQIPLSNPA
PSSYMLQHSVPPPPHTGDTSGQHGPVSSLPSNEWGNVFSSPLDPSTFAALAASGVLGPPT
SGVPSSLPARSTRSPHDYPINPRVPPPLNTKDIGRPAINQNLHAPWSNVPSPYSSTPSSS
QRASPLHFRPGSGSIPYGKRKYPIISPPPETTLGQQIPQSDLPGPSGQFDVPLGPAGEGR
LDSFSSSFSHHSSSVDVGSNLHFQHERHNITLPPSLWMSPTSVTSQSSLNGPSYPQLSEL
SMSRHGSITDSLSGSTHSPTNLSLYGDSTKSTAPTSASSPKGRMFTGLFTEELFSGNSPL
ENPGPHNFPSPRLSGSPDLKSIELAMADADPEKLAKEDPLATQVWKMYARTKATMPHAQR
MENITWRMMALALKKKKEDEDRAKGGDLQSEGQVDGQPSDPTQLSSDDILKEEQTERGRT
FDKGKGKVKVVGFDGTNQDGTDENDVVPMDWRAMSRSRSRVPMDWRPASRSRSRPPLPGV
LSDLGSLKFPSSSPPKGLSSSPGLPIPGSSSLAGRRSPRQGLPAVLESDTRGPLGHIDPL
SALSSPTNHPSSLPSFGLHGLQRLAASTVPSPEQRTFPRHVRKTSFDHTVAREGIFTGVS
GRHQVNGKPLSPESVLGTKRRADAPHVDCMLRGDPSAMSHSEHIDAQDVDHMRRGSPFPS
SSFNFTFPPYDSFFDLPGANTLPPPSLPSSLSSAKDIRSPEAAFHDSLRSSLNGSSYSVG
PGSEGLSAAAAAASAAVADGYAQLNVGNLGLDDQPLDYTNLVGMMYPLDGSSGMGPITHV
DPHQILPVEHQEGPFGIFHPSPSSDGWGNGASSNASPEPYTSNASTPPSAENGAAARNPA
RKIASSKRVSQDTRAGGSRKTPEASTSGRNASDDGDQNPTVCTNCQTTNTPLWRRDPEGQ
PLCNACGLFYKLHGVVRPLSLKTDVIKKRNRASGTPHSASRKGASALPKITSSATRPRAA
TTSSMPSGLHNARLSPTNRMSAGGNASMKRQRRTSTSITQSSSRKAGDDGVALVSCNPRV
AYPLLDTALHVEGSRIVVVYPCPLTPFILASLFRQPSPRSPIPPSSFPNTLHPIGSNDRD
LNVIQRRTSRTELDFEQALRAGGTVLIREGLDVDALGADLSNASISFSPSSQKPYVGFQP
ATPTIVPPTPSPRAGPSGSSTRSSLLPASSTNESGIEPPEHEYQTKRRSMYRSPGTASSP
DLATLLRKAKERSGSASKDGQSSITPNRPDTSKGTIRQRSTTTMSSPQGSPAPKGKSRSN
QFLGVDTDSGSASPEWVLTGPRSPGPPKRTIMSSPSTTSVATYAPSPLMDAFTPPVPPIP
PKHRPQSRVEASDVFSSPDMNKTLPTAPSKGASVENLEDQSLVIIDEPVGRSRSPSPSTT
VKRRSSNQVQSKVPSRSKRRSMSVSDADLKKVFAMAAVSNAGRMPTEGRRTEGTTRSDRT
LSGIISDFRGELSQLDPISTGSLDLHDPTTPSRRPALAALRARSDGAAAQVTPPRPSLQS
AASEPAQHTAPRLTLHLADAPAETESAHSSPIQPQFAQEGTSDASRTAPAQTQTPIRSRS
GSSALPPRMSSLKYGPRAPTMRTGSGSLLPHSPTASRDADRLRVHHRSTASTSEPSLIPE
RDDGRVRTGFAASSQQDLTTNDLLATRFNVQSGARQSPSRAEESADLDARGKELATRCWA
EDEDFLAKDKIAEWLGGQSLINKTALRHYMDFFDFSNLRLDHAFRRMCAKLYLKAETQQV
DRILEEFARRYFECNPTTIFGNASVVHAVTYSLLLLNTDLHVAELASRMSRGQFVRNTLA
TIQMQLQPNQGSNSDLSYDDWTSFRAGSDSDVGGTTIRSRAKRSDSIASWNSIATRDGQA
QVNGSTVSVALSTGQELKEAKSSDPPPATFVPDRNWETEMENTLKSKEPLAGGVSNMEYG
WNRVLDPLTRVRSISEDNYSVRDGDNEDGQSVRSGKSGRSRIKEMAATVRADKSPWADRT
FINEWKPPMPPTVPSNHDEETQMEALQKHVSSLKTELKLHNELRTPMMNMYQPRSSNGAK
ALSNWEKKSQYLLTEIVKYESYIDSLQAAMSLRLKKRGEKALERALVVASPTEEELADTA
VKPRWKGQPDEETIEEGEEPAVSAGQDPSPVHKHRREVAETGEAGGR
Download sequence
Identical sequences jgi|Pospl1|128977|estExt_fgenesh3_pg.C_1830024 104341.JGI128977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]