SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129146|estExt_fgenesh3_pg.C_1250014 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|129146|estExt_fgenesh3_pg.C_1250014
Domain Number 1 Region: 144-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000627
Family Ribosomal protein L24e 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129146|estExt_fgenesh3_pg.C_1250014
Sequence length 286
Sequence
MSKPLFHPCGILKSNRSLNDRERQPSKVIGPLIHALIRCLIGTLRAPAYQNCAREYRAVS
AQAVGKVAATFPLSYSRRLIAPVVGTTGATGRRLAQHCHRAWIEALGIFGADAANADASA
QTGKDSVARTVPDNIPGKSARWCVRPGVCQSYAFADGMQWSVFRFATSKNESLFLQRKNP
RKIAWTQVYRRMHKKGITEEVAKKRSRRTVKHQRGIVGADLAAIAARRNQTAQVRAAART
AAIQKAKAEKKDKESKKEKTTKPATRAPAGGPRVSKQQMKGGKGGR
Download sequence
Identical sequences 104341.JGI129146 jgi|Pospl1|129146|estExt_fgenesh3_pg.C_1250014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]