SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129274|estExt_fgenesh3_pg.C_1180047 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|129274|estExt_fgenesh3_pg.C_1180047
Domain Number 1 Region: 114-447
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-49
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0018
Further Details:      
 
Domain Number 2 Region: 4-91
Classification Level Classification E-value
Superfamily RING/U-box 7.3e-19
Family Zf-UBP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129274|estExt_fgenesh3_pg.C_1180047
Sequence length 469
Sequence
MYLDTINRAVLDFDFEKVCSVSLSNINIYGCLVCGKYFQGRGRNSYAYAHSIHDDHHVFI
NLETTKVYVLPDGYLVSDPSLEDIAFVLGPSFNRASIEGLSSPSHTQKPSYDLSSKPYIP
GYIGLNDIKRNDYMNVIIHSLLHVPPLRDHLLLSSFRGKEPELLKRFATLAKKIWNPRLF
KSQVSPHEFLQEVGRASAGKFSLERQGDPVEFLGWLLNRLHKDMGGTKKRNSSVIYSTFQ
GQVRMETQQVVVRPDLGGNEKPRFDIDREIKSTVSPFLFLAVDLPPPPLFQDAVEKNIIP
QVGIHSVLTKYDGRTTQESAGQLRRFKCQQLPPYIILHFKRFTRNQFSEEKNPTIVNFPL
RGLDFRDYLDVSQSHPSTLYDLVANVTHESAAGTTRDKESTVWKAHLRAGAGGGENEKWF
LIQDLIVEEIRKEMIFLGETVLQIWERRTEPQSYHNGDGRYGSAMNVDR
Download sequence
Identical sequences A0A1X6NEF8
104341.JGI129274 jgi|Pospl1|129274|estExt_fgenesh3_pg.C_1180047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]