SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129294|estExt_fgenesh3_pg.C_490045 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|129294|estExt_fgenesh3_pg.C_490045
Domain Number 1 Region: 57-183
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.68e-18
Family FHA domain 0.0045
Further Details:      
 
Domain Number 2 Region: 220-268
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000106
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129294|estExt_fgenesh3_pg.C_490045
Sequence length 442
Sequence
MLRRRRSAGTLAASATPQVPVVAQARTTVGALSASAPSGGQAFRIRLVPHLASRTSLRFD
PICRDVREGDPALRIGRFTDRSGLGLAAANALGSHKLAFKSKVVSRAHAEIWVEAGGRFF
IKDTKSSSGTFLNHVRLSAAGTESSPSELRDGDLLQLGVDYQGGNEDIYKCVKIKIEMGR
EWQAHANPFNANALKQLKAIAIPHASPLEKKTAPKSALPDCCICLFGVTINQALFIAPCS
HAFHYKCIRPLLETHHPAFSCPLCRTFANLEEDVEVEIEGEVDTESIADVSAAIASVVAV
ERPNTGDGSSRERERDRDAGAETEVEADTGMSRRGRRMPGNGAAPAYMLEPDVHVMAEDV
DEEMDDAAVLPPLPEGSPLLTAQEWAHDIVREASASPILVPPPAHAQGEYSEGEGEGSGE
GGSEGSTGGLVGGEAAHGKRKR
Download sequence
Identical sequences jgi|Pospl1|129294|estExt_fgenesh3_pg.C_490045 104341.JGI129294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]