SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129296|estExt_fgenesh3_pg.C_490048 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|129296|estExt_fgenesh3_pg.C_490048
Domain Number 1 Region: 386-422
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000684
Family Ribosomal protein L24e 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129296|estExt_fgenesh3_pg.C_490048
Sequence length 518
Sequence
MPPHLGITHLQGFHLFPPAFTVLPPHTASRSPRWLRPISISHPAHAHHSAGSKSSQLDLP
QADGAAAQRSHARTASATRRAYQLRTLLRPRNHLRSGPTADDRCKSVPGRASAKEDSPRL
RYGTATSMDRGPAGRRGGRTLPEDLVTYVPGMQRTASAGPRGARGVGCAMTWSGTQAEPE
VRTEASGTGDSVANCKEDATCWARVQGNTHIGEAQLESEQIGEKIHVVRRRPGGCIAQCD
SDDPEPGKSTERQNEEGFRVGMPAAARLQQMRILGPEFSRASVRCPTAGFTKGGWKSAAT
GVASETDSQLEEKCSEVDAPAPPWIGALGIFGADAANADASAQTGKDSVARTVPDNIPGQ
SASKMLIPLAFRVACRIDGAYGRVSVRVMRSLTVFRFATSKNESLFLQRKNPRKIAWTQV
YRRMHKKGITEEVAKKRSRRTVKHQRGIVGADLAAIAARRNQTAQVRAAARTAAIQKAKA
EKKDKESKKEKTTKPATRAPAGGPRVSKQQMKGGKGGR
Download sequence
Identical sequences 104341.JGI129296 jgi|Pospl1|129296|estExt_fgenesh3_pg.C_490048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]