SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129302|estExt_fgenesh3_pg.C_230008 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|129302|estExt_fgenesh3_pg.C_230008
Domain Number 1 Region: 298-610
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.62e-64
Family FMN-linked oxidoreductases 0.000036
Further Details:      
 
Domain Number 2 Region: 636-697
Classification Level Classification E-value
Superfamily Rps17e-like 1.09e-22
Family Rps17e-like 0.00075
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|129302|estExt_fgenesh3_pg.C_230008
Domain Number - Region: 87-113
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000288
Family CCCH zinc finger 0.0053
Further Details:      
 
Domain Number - Region: 158-178
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0563
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129302|estExt_fgenesh3_pg.C_230008
Sequence length 780
Sequence
MAMSGLPPGTAPIKSEFLVSFAPRDLPDDDAAEGSTTHANGRRDDADPDPEGGKRLSGAQ
RKALAKEERKNKRGANKGRRFQKVRDEVELCWKVATGKACEFGAECRFTHDTSAYLAAKP
RDVHFPTSEDLTNSPPFVRPLVDEEMINEKHPSVDFSTRCPIFERTGECKHGLKCRFLGG
HVREGEGAILELNINEDKKADTAIAETEVNFIDANTLKLIRTKKYPQPISEAYLKVLLES
TGDDEKGSKGSQPADGEIQPAQKIMQTATTQVDTSQNDTPDVPIRFAEKKRLNWHGKTYL
APLTTVGNLPFRRLCVDYGVDITCGEMGLALSFLQGSKEEWSLVRRHPSESIFGVQLAGS
KPSLLVPAAETIGRECAGNLDFVDLNCGCPIDLVYKQGSGSACKLGKIIAGMNKALGEIP
MTVKLRTGVKDGKNNAHKLMPRVAAEFGASAITLHGRTRQQRYTKVADWDYIKQCVEAVR
AREADEDLPPVPIFGGGDCFSSEDYWQKMESSGVDGVMIGRGALIKPWIFTEIKERREWD
ISSRERLELARKYAEYGLNHFGSDTAGVNTTRRYLCEALSFQYRYIPIGLLETLPARIND
RAPAFRGRDELGLCQAIGSRFIPRPLTVHLLRLVNMGRVRTKTTKRASRVLIEKYYPRLT
LDFHTNKRIIDEVAVVPSKRLRNKIAGFTTHLMKRIQRGPVRGISFKLQEEERERKDNYV
PEVSALDTSVNGLEVDPDTKDLLHSLNFDSVQVNVVTPVLAQPERGPRRERRNVPGAGRS
Download sequence
Identical sequences jgi|Pospl1|129302|estExt_fgenesh3_pg.C_230008 104341.JGI129302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]