SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129321|estExt_fgenesh3_pg.C_230076 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|129321|estExt_fgenesh3_pg.C_230076
Domain Number 1 Region: 182-254
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000596
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129321|estExt_fgenesh3_pg.C_230076
Sequence length 630
Sequence
MSSAQTHNAGPSKVSKSKRILSDSEDTSERETSRVREAKRPRHADSLIDIDQKRTTMDKD
KKKRRKRKRKQSIVQSQNVLLGAGGALNAVTAQAAGHSRTRSEPPTARRRRQTSVGLSSV
TLGSQSPEVQPKEISTNDKGKARASPELERPPTGSAAGITDLTTQLTAKTDLVGKHTALL
TTLQQSLTCQICLDLMHRPYALAPCGHTACYDCLLSWFRAPPADIPPEEATQPWMRKKTC
PHCRAIITERPVEIWTIKDMVNAIVRSDLVELPASAPAPAAESSNTNADPWENIFRRATA
ANTNAQRQTMGIHDPDDGGVWRCEDCLHEIWDGFCSSCGRMYTGHLPWPQDPADDDSEYD
HQELWDDDGDLGAAWIDMGPLGGLGALGWGYGYSEDDEDGSVSRDSGSDEDEGHDVALPP
RRGRRRYSPVREAAEEHERADSEEDGSYESSFIDDEDDVRPTWLYNPLLRPWTPEQEPSY
DDHNEESSRSPNARVGSRAATRVVSSEEEEEEASDAPAQHPGRVQRRATQLVIHSDEEEG
NDREAFAEEEEEDGDLADIVAAREREIYGDDGSVPHSRYEHGLDEDDENEDISDAQGTWS
DGYDPAPPGAYGDEDESRAYLFSDEDEYEY
Download sequence
Identical sequences jgi|Pospl1|129321|estExt_fgenesh3_pg.C_230076 104341.JGI129321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]