SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129355|estExt_fgenesh3_pg.C_770054 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|129355|estExt_fgenesh3_pg.C_770054
Domain Number 1 Region: 1142-1210,1550-1746
Classification Level Classification E-value
Superfamily ARM repeat 1.4e-20
Family Armadillo repeat 0.068
Further Details:      
 
Domain Number 2 Region: 356-502,541-755,1559-1758
Classification Level Classification E-value
Superfamily ARM repeat 3.54e-18
Family Armadillo repeat 0.096
Further Details:      
 
Domain Number 3 Region: 2475-2506
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000235
Family CCCH zinc finger 0.00068
Further Details:      
 
Domain Number 4 Region: 2510-2540
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000102
Family CCCH zinc finger 0.00077
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|129355|estExt_fgenesh3_pg.C_770054
Domain Number - Region: 1009-1077,1130-1236,1289-1306,1389-1468
Classification Level Classification E-value
Superfamily ARM repeat 0.0633
Family Regulatory subunit H of the V-type ATPase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129355|estExt_fgenesh3_pg.C_770054
Sequence length 2789
Sequence
MSDYFDRPESTLLILQSMDDEDISMPESPSWESGTMTPGQSAFEKDKVSMQSYLDSLPYE
CESIDEMRAKLDHIVSRICICVESKNWLVLTTWDGMLQCLIGGHSGVYSRKSYGRRRGSM
TSQQCRRYYPASEIAEMLTTFLPLVTKETMLTMFPVITSFLPPTHTELYLPPLFKLWEAI
NSSILDDRMIDLCGDLSEEHVAGKLGDAGEEGGAAWKDIGIWSENEWHILANKALGSMNV
PVGATRGASTTASHADHMADKQTLRIRKPINRANGLAKLFVYSMCLDGPVRGEVTAASQG
SSMSPPPTGFLAGSRALDALDKLITSTESFFHPSNSGPWTLVLTLFLHRVTAEFSKRWKE
EQEQSCRTPITRRLTPDIRRAFVTILRTPALLAMFSKDPFSISYSQAALRSLAFIEPSLI
MPELVERAYSGLEVINETHRTTAVMTMMAAVAHPLVCEKAWVGGQKHVVTLLELTLPGID
LNDPIKTMCAAMFIASVVQYIKIGDISMHQAGVALSDDAPAAEVMDVDGSDAVPLPGGLD
EHGMPVLSREEERQLARESTAGFADWVTSLFRRIFALYENLPEEGGKRNTTGGKTEEGVL
KAVKSMLDVVCLNMSDQLFDLVLNLVYDYATTNAKSNAVRAFGQLVSCLARIRPEKTIDK
FLPYCIAQIQEELKHGASSTRTTSVHASVPSDTTLHWNMAILRGCFGYGAEVFLKYKTQI
LGLMSLLIDKCKSERGYSGTGRLINRIMYTMTSAYPIRARFLDADEWNNPDVAQNHTAHW
GRLYDPQDVKIEWHGPALDKVESLTAIAGKWDDVARNDFCRYLHAVRSVWSGLSNLFQEG
PKEVVNPCLDQETEVPELLLTHLDVKACFVLTDPHDPRYQRAVAHRLRYGRVIHQAALAL
QKPNGGEDHIDALISLSKAIDVYLLEYAMTRSNFDTLRKSYAQAREQFNSHVVEAESHTE
DGPHQTSARLSWRKSIHARLIPSKITNMLKPFSTTHAASYFVRSTRMSLPFLFEALSRGT
DPDRMKGALYVLWNKGTAAYALADTRSHGRYLVSLLECQHQEKPSIQKLVGNLAQDAAVY
LTEEATHTGAFLENIPGVINALTALKEEYPVTSEDHRILAHAIQKVPGRAAAKNRHHEDT
VSAILQIADKPNIHWRYVEIATTFISGLLRRDAAPSPELAAFLVQHSISPHPTIRVIAQK
AVSRMTCYIKIRTFAKTTEELWLDEWHNPLRTTVTISDPTAFLHGLEQPIRKQGDVEEVY
VDKITTGFFMWSSSVKAYRAVQGQESSFSWEQASRPALDAMSAILKEGNYFNKLALLWGQ
ESTRNNSTPELRADNIVFMKSLGSKHWPRSSSDLVWTWMASRLPLIYANLKPDTITFWEG
MFSEQLVERDPRRAKPIVDFIISLPLEFHGDSTFAMYKSLSLFTILIESLGLRFLPYSAR
YANLFLDNANTGYAETRSQIAQSLYTVVTTEWRPVYPSAAAFVQACRAEVDPLRIRDAKY
MDRIMQIVEQLPHWRNERLPPPRVSQSQYDKVGLTILQWIWEFSHGPQANLILPYAVALM
PEILRMSELNDSSELQKYSSAVLYVLSAVSPPTDYIVVIMNNFIDLIKSSTSWRVRVNAL
PTLLVFYYRNLMSIPSNLVTRLMEVLLECLSDENVEVREMASKMLSGVVRCSQRQSIVPL
RDRFVNLARKTKLPNRQHPAHAESLRLLHSAILGICALIESLPYSVEPWMPPLTDVLATH
ATDPAPISTTIRKCASEFKKDTWHKDQHAFDEDQLQNLSTMLVGTSYYVEMYHCDSIFDA
EGVACPPEGFCQTRVFKRATFARTSWPETRQEDEGLAVTRRATRPPPHALYLAYLTRGEN
LARTRAKGSGRKQAAREPRWRSIVPLCERSRDSADVRIADTAWGARSRKRCRNESCTGMR
RTQGLSMGARPRKPGSSVKAFAAELAGHLRGLGIILRLGWSSGRDRCRSRRKYIKTQWGD
FANAVNRMFSRRDSDRHTSRGAPYQGDGITIIKMLHDSVTNPSNQTTFFAQHSDDIISPN
QAKTNNNLGLNSRDMLPGTRRAPSGRMQTDSATAGWDLGDEIGKMRLGDNGDGDEPQLHT
PPQSKAHAAALVQFQEASPLETSSEASIESGSSTAIDRQVNLNHSRESSADTSHSGLSSA
SHTLRNATLTPLKIGVVGESRNRPHSYSGGLSSTDLTRLQQVGGSPASKGESWISPHGTP
ERQPQADQPTYPSLAQAGAARLQQDQQQFTREDFNADYQQRQFSPQSAYPQGRTANNGVS
MPYRQPARQFNQQIPVQPVIPSPTSFGYPAPPPPPPLAISNPQQQLYDMMLATPPLDNAT
IARLQQQHNAFRNAHQHTVSDPAAVRDPAALALLNNNLQAFAASQLYPPSLAPPAALSMF
ANQFYGAPQDAYSSPDLAAAQLMARLQSPYAGAYGVPLPGQNMPLANPAVAAAAAVGGVG
GLNAGPSANNRKLGLYKTELCRSWEEKGTCRYGAKCQFAHGEDELRKVQRHPKYKTEICR
TFWVSGSCPYGKRCCFIHTELPASGAPPGADGAPPPQVPHGRDRSGSTNSDPNEVSTSLL
ARISAKRTQEGTINSNTGSVSTTPPSSGFQLNGRPGALRVDTSVLDSAASAKQNKSAYPT
FAHNGILMPAKEEVTARSPGPVTAGPDFGRHASSRLDIVGTQQRIGKNTASSPNVRHSFN
GSDIQLDFSTTPTATNAPSQLGSSPEMPKSQSRINGHVRSGSAGNWAGATRSSHLTAYPL
SSIPGGEVKASSPWAEYSVGSRLVEKNWL
Download sequence
Identical sequences 104341.JGI129355 jgi|Pospl1|129355|estExt_fgenesh3_pg.C_770054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]