SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129455|estExt_fgenesh3_pg.C_790023 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|129455|estExt_fgenesh3_pg.C_790023
Domain Number - Region: 265-288
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00033
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129455|estExt_fgenesh3_pg.C_790023
Sequence length 795
Sequence
MMQIYRNEYGEGSVHLVVIGRRAESPGQTNHDISQRRPQSRTSSNDSQDDVMSPIGWRDM
HWPQVNTMGEAAGQNTELTMLERVGLFTLLVTTENITALRQTMGVPSREHEMQLNHLSAE
RKHARGWDHLPQTQGREGFEVGRTVYTLQPSSSYHPQDVSLLPPPKRHQVSPAMLGSTST
SLPPSLRQSALPSMTAADQQRMDQNVAILLNAQSGSHLGNCAMRDRWAFMAGHASETRGK
IAADYSLPKMMFLHTLSLYGTCSPTAKLCRNFALGYCAQGSHCQYEHPVANPFAMNFPIL
SSLFNTRRSPYKTSAFREDFPRPAEVAPTAVARPLQSIATVGPTYRACVTSRIAPTYIPW
QSIFPPPPLLPLPPPHPFPPPAYHYGPPPGAPVPKSRTIYATPPLSIHTPFSGETRRPPA
RDPSVPRSSVSFDPIVEQLAQADAEFNVPPQRQRAGHARRVTVALRSKEDTDALGLFPRK
TSRESWQTHGSRGTHKASCDPIRDVCATDMYFCFHRAGHPHPRLRAFCWIGPWHLFRRDL
FPVDEYHVFAFIQCNFPQYLRVHPVLVALLYYPSAIFFSAVPELPPSMAMAMHRNPIQYD
TTVHPRRFRVLRVHLTSELRPALGPKLTGPSATCKERIPPWGTATRPRGTREGRSRKARV
NRHDRPEILRIWTPCMIAGRPVSNGRPPLAKYTSILGQGGAELQKRAAGAGSRAETATVQ
GERLRATEDREVHACCDPPVLAPSWSVIDDISIPLRKNPLYTCLAPGLMVRLNELSRYNR
VLSAAMLHVVYLYFL
Download sequence
Identical sequences jgi|Pospl1|129455|estExt_fgenesh3_pg.C_790023 104341.JGI129455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]