SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129790|estExt_fgenesh3_pg.C_120067 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|129790|estExt_fgenesh3_pg.C_120067
Domain Number 1 Region: 188-282
Classification Level Classification E-value
Superfamily RING/U-box 0.0000327
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|129790|estExt_fgenesh3_pg.C_120067
Domain Number - Region: 1006-1054
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000734
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129790|estExt_fgenesh3_pg.C_120067
Sequence length 1070
Sequence
MSGDTDVLSELLIARILEEEMLALIHTQEAEKIQVDLMIDESDLLAGKGSGKHKAVAQDP
ISDSDGELVLKMVIKELRMSSDATLAQALQHSDDVTIIAGQQHAQRLAAAEKKLLLDAEF
ARRLQAVNDGNADIDTAEYMDAETVLGRETIEQLLASDPNDKGKKSDTGKAKGKSPVSLK
NIKQSLQDDETMNKDVDVPSIAYPICGICMEPFQATHSPLASSASANSSARLPFGLRLPC
PGSHAYCMGCLCDYIRSKLDPDGDGTTSMNRVVFPIRCPECPLIEWTDGIPDEVAARILP
EKSMVLWRHQKLLDSMPRYYCPNPRCLAVVWHESPALAQMPELLCMFNLPIVKQCALTND
IDATTSHAAARRSSASAADMLLEEREREREHRQGPVAAAVRPVARMFAPREESPPPYEAP
PVPPVRRAARGTFGWMDDPDVFCTRHWFTTHMIQNLTCGYCDVKLNSIADLRYHLGRVRR
HDVFACCGRFFKREEDLERHLNAEPTRFGWHVHTRRNSRIRCPKDWLVRWDEYIYKVYDL
LSSLVVYRVIHMKAERPQLAIDMGSVTDIMTLAKLSLRLIQAANSLRGSATEFKDIYSTV
CRFEAQMEAIKQSVSRFSEEVTATFPDLQEDFESWRKAAQEIKILLKPYQHTLGSTTKGR
KFKRMVHAVKWRILDERRFSKLKSALDTYRSESLLAFLALVGNVLFALSEDSSNQRRAID
RQHDEQMSMMQTLLTVMHQVAPQVHFGRGNTFVVTDILGKRLVLPTVLYRDLTNLHAYLQ
EHFSGVHSRQQPRIGHSFIRRGSYKLSLVNENDSGKYRELDITSTAWSQAVTDGAEFVMA
IIMRDKELEFEHTKRSCPRCDYFIRGVPDRDGWLECESCEVRYRVFVSGSSDVADVGLAT
SDATTRVARLSNAGEDNRHTAHQGRYLPEDAPPDENARAVAKFCHRIQVRRATNICRWRK
CGLPLDDLSPAGITRHLRAQHFAESSDTLLNWEKRSRGSCEWSDDTHACGRCMSHASFGK
HIAAVHLGAISRRCPECNRGFVRPDALMRHQLVLRHYGDLLPTWQIDSAT
Download sequence
Identical sequences jgi|Pospl1|129790|estExt_fgenesh3_pg.C_120067 104341.JGI129790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]