SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|130061|estExt_fgenesh3_pg.C_60026 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|130061|estExt_fgenesh3_pg.C_60026
Domain Number 1 Region: 244-299
Classification Level Classification E-value
Superfamily RING/U-box 1.37e-17
Family RING finger domain, C3HC4 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|130061|estExt_fgenesh3_pg.C_60026
Sequence length 366
Sequence
MSSTLLRAAPIHALSLYVCLAYLATGVAAQTGTQTTGGPNTSLAMIILYAITGCVSALFC
VVIVSGAIRAIRHPERYGPRTGEAGFDGATAQSRARGLTRAILDTFPVVKFGVDPATGEA
PRPKDIENPDEESYELEVHAHSTSSKDGHAETQTIEVVGSALADGRGASANRDEADGDKE
ESDVTNARPTAGQNGEDSFGAGSSKADAEPVVRPRMRPGRSQSVHQGDAGGNGGTAVKEV
VPDAIGTETCPICILDFEEGDDLRILPCEGHHRFHRDCVDQWLLELSSSCPICRQDFHAL
EMMMAGEDDHLEPPRMPAAARPLSTAAARFSRYLRSARRRHDRHREDGSGFDITDPPMPL
APEGRY
Download sequence
Identical sequences jgi|Pospl1|130061|estExt_fgenesh3_pg.C_60026 104341.JGI130061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]