SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|130192|estExt_fgenesh3_pg.C_1460015 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|130192|estExt_fgenesh3_pg.C_1460015
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily Double-stranded DNA-binding domain 1.05e-21
Family Double-stranded DNA-binding domain 0.00054
Further Details:      
 
Domain Number 2 Region: 230-308
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000458
Family Canonical RBD 0.0012
Further Details:      
 
Domain Number 3 Region: 164-197
Classification Level Classification E-value
Superfamily RING/U-box 0.0000135
Family RING finger domain, C3HC4 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|130192|estExt_fgenesh3_pg.C_1460015
Sequence length 1494
Sequence
MNQLQQSTPRGGESGEDDGKRAAEEQMRRDLLATVLDSAARERLSRIALVSPQRSQQIEA
ILLRMAQTGQLRGRVSENQLIDLLEQAEDAQSKGAPKKGTIVGPSVTRHSDHYSPGNWRQ
HSYLLSPSSGIDVQECLPNQRQAQSKSHVLAGVQDAYWSDDEAICRFCWHHIKENLNRRC
PACRREYTDETVQFKPINKEDHKRLTQQKKQRERERKELDALGRRHLANVRVVQRNVVYV
VGMGPRFAKEELIPTLRSSEYFGQYGKISKIVIVKRTPSGGRAPVVGLYITYHRREDAAR
AIAAVDGAPSPGGGHEIMRASHGTTKYCMAFLRGVTCTDHGCMNLHEWGDEKDCFTKEDL
TTLKHTMKDTETRSRTTTTVRKADEADGEAYLNSKTSFVWLILEPQGFPAQRRGPTRPQL
RSSSTARQPRRGTGTRQQRSGSTPTTTAEPRSNGKDRRGAQAGKAPSQASSSRPATPSHN
RPATPSAGKVPKLKEPSPPPVPARSPTPSATAESDSGSAGQDTTLVASPECTPPPKIPSA
PPGLPTVPPGLSAPPGLPPPSSRTTSAMASPLQISSAQSSYQMSSQAQALMEDLKARREM
PQVLTERSPFPDFDRMLQTLSGGDGDGGFSFNLDPALAGEAADAPLNLPELEIDASTPFH
GTFLDTFPALRHNPAASPLMGPPGIPYPPRTLYDSLGMRQPTIERQSTGSSGYTGSFNPF
ADSNEESQSKRFSPLDEERQVSRFGFARGRQGSSSSSVHPASPLSNVDNVPHMPFYNSSE
HNSPVTRTPPQWTYQARQPLHGFAHHDGGSAMSSPLARHAQAQSLYQQQQPQLSSQFQPF
DSGVSEAQLRELITSSRTNHMRNGLSDQASYPVNPTQPFNDPAIMSARLASPVLSQAVTN
HGFLKIPLVDSFSPSHVGYGPPPGLSMANGPVTNSPSLVNHHAYGLANRTVANLEVAQTN
GQVSTSPSLEPSVAPSPALSSSDFPALSAAVELRREQPHSGPTSSAGTPDVDSAAQTKAD
RKAAKLAERQRIAQEKAATKAAEKERRAAEKEKAAALKVEKDRLAKEKVEEERIERERVE
KQRAEIERVEREHAYKERVEREQAAKEKAEQERAAKERLEQEKTEKQAQAKKAAAAKAAA
SQPPKQSDGEESAQSENLPKHTQAAKQTPAGSPKLAIQVPILSKMPKKSKPVTKPIKIPK
EDVISESASALPSATNSEAPPFPDGRGTESSSNNSRAQSVDHSLISQTTSVERMLEDLDC
EFPHLHISEHPFFDLQKINPAAKMPLEYGPLVHALSALSVGGGSFANNMPSGSIDHAVSS
FQQLLETLTQTISDLLRLLPRKTWDDNSSFDGVLRDMLKGDDFLDEGEDQNGQVKEDEVA
ALTLALERRARWMEVQLSKLEELHRDINIAAVRAVLAFNDNGWDYYQSLPRVGNTLARFD
ILGIINENDEARPMTADELEEKLLKAKDAAAFAEAELRESMQRLQVMKPAHLEE
Download sequence
Identical sequences jgi|Pospl1|130192|estExt_fgenesh3_pg.C_1460015 104341.JGI130192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]