SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|130219|estExt_fgenesh3_pg.C_1380032 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|130219|estExt_fgenesh3_pg.C_1380032
Domain Number 1 Region: 773-831
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000235
Family ZZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 729-765
Classification Level Classification E-value
Superfamily RING/U-box 0.00000141
Family ZZ domain 0.022
Further Details:      
 
Domain Number 3 Region: 599-627
Classification Level Classification E-value
Superfamily RING/U-box 0.00000188
Family ZZ domain 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|130219|estExt_fgenesh3_pg.C_1380032
Domain Number - Region: 563-591
Classification Level Classification E-value
Superfamily RING/U-box 0.00953
Family ZZ domain 0.059
Further Details:      
 
Domain Number - Region: 1741-1773,1800-1826
Classification Level Classification E-value
Superfamily POZ domain 0.04
Family BTB/POZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|130219|estExt_fgenesh3_pg.C_1380032
Sequence length 1890
Sequence
MSLTDPAPVQLYKVFPVSHSFYLSKLLFSPNSSTAARRILIGMEAHSAEEYNEHIAPYQG
RTWPGAILKFSVVDETPHKSPRASSSNRTSMISTSSLDSARTGTEGASQSSATVVDWTAA
SIRRRKGDERRLIIDRLRERTTTRSTVGPLSPSSPSGPPSPGASPTITILPPSPPQSQPT
PRPLPPRPDRTDSPATGSSVRTVRPSLFDLLSEEPSTVARAFTDKPPTRSIFDVFQTEMN
ATDASNSSTLPNTQRSQSTRVQDFTAAQSGNDNEPLFVIPPPPVMCPVHWSNVQSARSSL
VIPPPPVLYPTASSNTSAATPLVPTNNRDDIVMDSPSSELGPGTLQASRSDGAQHPESSR
QSAQHQASGPGGTRNPVATLQATPANVSSQGHSVNCCSVSRTKAEIETIVDNVMFNIERI
MKRAFGDGWEYRRPSAHGPDCGRANSSSCGPRRSQGNDTSVLHARTSIAPGYHRHNDLSM
PPSPGKTWASGQSDFGWGSPQVRSPFPQPPCSLFVPPPSQFQIPPEGFMPYMPPPHFAVP
PPPPLPSFVSPAPGWTTSWTPQRDFDLCSACIARPGVLEQHSTNHSFLPILSGNDYKQTS
HMGITCDGCNKRRFPGVRFKCLECDDQGLSTPTTVPASAWWMLACPKRRLNPHLQVLREN
LCLPYAFPLDRQAGIFQFIATYSATTVMTSSCIAQPGLLATHGPRHQFFEIDRPGEVIVH
TVFSDNDEKCMNCPDFDTCSSCFQITAEQHPDHGFVKIERPDNLIVRNALGSNVIHGAVC
NVCRNQIVGIRYKCMHSSCLDFDLCQSCEALPFPVHPPAHPFLKMRKPDAAIPAVRRPEA
AQPAMHDLLDQLERTMPSESGRECSLVEELLATEECRRNPVTIQAYSSNKPDAADSTWMN
TPTSLIPEDVESHERSEGVSDESITRTSSLAPTAIDFPTSFPDLTPLESLNNNHWDEGVR
PTSLLGNVAIADSTLLGRLVNDVISTPTAEPEVVPSSPLTVSMALEQSVSPVGQPHVTEA
EERLIDYGETNTEKDQRIEGESTLGGLTTPSTTSSTSIPRLGPVNNEWRELWPELTSMLK
HLLQPTTPTGTPNAAMTVEEEMMPGAMIVEQPKAGEEQDISKAVEESPLVGEPLLCRPFG
ARVGERPLHAVFDETVYRSSSNTVPVSEQSRNSIFSVVSSTTLPARESSPEPVPQPLLAS
FVSDNNIPDGQIFPPGAEFVKSWKMLNNGRTEWPESTELVYVAGDRLAPYEAASRRAHVG
TVKAGAEVEIVAGEMKAPEIPGRYVSYWRLSDGEGNQFGHSIWVDITVAEMTRAMSALSN
DDHSLASSSIIMPQPAEGASAGLPTVVDEHFATADSAPTVSATLPSSPPSEDGSSDSSIS
LVDAPDSPLSDDDEEMYEDSRSHMVAAPNARVQDPDYVLLYTDVPSLDYSVNLPQKTSCR
MASMTVQQDAADFDLSVRFRIDNLRELLTDSAETEGVEVEPRMSNAFWPGFMFKVSRAIE
GKQRKCRLSLYMLPGDCSTPTIAVYASVSVQSLSGNHTYSTKALKRQATFDHGRTTIGTL
LSQKMYEASYTMQRENAAIVLVTLRSSNAPTPRSSPTLNLIHRVLTARPISNTRFIVFRR
RDSTGRLSCPRAFYANMKDLASHYERCEDLLNIENSIEGFELPAGASLDDYSLTCDQHDY
DSDFERDEEEDDEDDDIVVVQSENCRQRARRPPPGGTPADSMMADDSVTLESIQAEVEEF
EGTTIVLLGAAARTWEALLYYLYTGFIDFAPLTSLNPKGQDEFLARYRSGNPHRPLPPSC
RSIYRLAHMLELDGLRKLALEYLESQLTPETLLTEVFIKEMELALVVRYWHALKASSAFK
NKMVEVTSGSVPHAADIISEIMMRVSAQKA
Download sequence
Identical sequences jgi|Pospl1|130219|estExt_fgenesh3_pg.C_1380032 104341.JGI130219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]