SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|130503|estExt_fgenesh3_pg.C_970050 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|130503|estExt_fgenesh3_pg.C_970050
Domain Number 1 Region: 724-784
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000114
Family ZZ domain 0.007
Further Details:      
 
Domain Number 2 Region: 615-674
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000789
Family ZZ domain 0.0056
Further Details:      
 
Domain Number 3 Region: 830-876
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000141
Family ZZ domain 0.027
Further Details:      
 
Domain Number 4 Region: 795-828
Classification Level Classification E-value
Superfamily RING/U-box 0.000004
Family ZZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|130503|estExt_fgenesh3_pg.C_970050
Domain Number - Region: 583-611
Classification Level Classification E-value
Superfamily RING/U-box 0.00671
Family ZZ domain 0.059
Further Details:      
 
Domain Number - Region: 1-43
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0343
Family PB1 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|130503|estExt_fgenesh3_pg.C_970050
Sequence length 1973
Sequence
MFTVKATYHNETRRFTFGDTFPTYEQLYNQLYKVFPVSHSFYLSKLLFSPNSSAAARRIL
IGMEAHSAEEYNEHIAPYQGRTWPGAILKFSVVDETPHKSPRASSSNRTSMISTSSLDSA
CTGTEGASQSSATVVDWTAASIRRRKGDERRLIIDRLRERTTTRSTVGPLSPSSPSGPPS
PGASPTITILPPSPPQSQPTPRPLPPRPDRTDSPATGSSVRTVRPSLFDLLSEEPSTVAS
ASTDKPPTRSIFDVFQTEMNATDASNSSTLPNTQRSQSTRVQDFTAAQSGNDNEPLFVIP
PPPVMCPVHWSNVQSARSSLVIPPPPVLYPTASSNTSAVTPLVPTNNRDDIVMDSPSSEL
GPGTLQASRSDGAQHPESSRQSAQHQASGPGGTRNPVATLQATPANVSSQGHSVNCCSVS
RTKAEIETIIDNVMVNIERTMKRSFGDGWEYRRPSAHGPGCGRANSSSCGPRRSQGNDTS
VLHARTSIAPGYHRHNDLSMPPSPGKTWASGQSDFGWGSPQVRSPFPQPPCSLFVPPPPQ
FQIPPEGFMPYMPPPHFAVPPPPPLPSFVSPAPGWTTSWTPQRDFDLCSACIARPGVLEQ
HSTNHSFLPILSGNDYKQMTHMGITCDGCNKRRFPGVRFKCLECDDFDYCSSCICKSRAY
EVHDPTHHFFPISRPGSIDAYYRARQRLVNARLSETQAQSTSASPPREPMSPIRVPTGQT
SGDLPVHRNVFCDNCHDQVVGIRHKCLDCPDYDLCSSCIAQPGLLATHGPRHQFFEIDRP
GEVIVHTVFSDNDEKCMNCPDFDTCSSCFQITAEQHPDHGFVKIERPDNLIIVGIRYKCM
HSSCLDFDLCQSCEALPFPVHPPAHPFLKMRKPDATIPAVRRPEAAQPAMHDLLDQLERT
MPSESGRECSLVEELMATEECRRNPVTIQAYSSNKPDVADSTWMNTSTSLIPEDVESHER
SEGVSDESITRTSSLAPTAIDFPTSFPDLTPLESLNNNHWDEGVRPTSLLGNVAIADSTL
LGRLVNDVISTPTAEPEVVASSPLTVPMALEQSVSPVGQPHVTEAEERLIDYGETNTEKD
QRIEGESTLGGLTTPSTTSSTSIPRLGPVNNEWRELWPELTSMLKHLLQPTTPTGTPNAA
MTVEEEMMPGAMIVEQPKAAEEQDISKAVEESPLVGEPLLCRPLGARVGERPLHAVFDET
VYRSSSNTVPVSEQSRNSIFSVVSSTTLPAREPSPEPVPQPLLASFVSDNNIPDGQIFPP
GAEFVKAWKMLNNGRTEWPESTELVYVAGDRLAPYEAASRRAHVGTVKAGVEVEIVAGEM
KAPEIPGRYVSYWRLSDGEGNQFGHSIWVDITVAEMTRAMSALSNDDHSLASSSIIMPQP
AEGASAGLPTVVDEHFATADSAPTVSATLPSSPPSEDGSFDSSISLVDAPDSPLSDDEEE
MYEDSRSHMVAAPNARVQDPDYVLLYTDVPSLDYSVNLPQKTSCRMASMTVQQDAADFDL
SVRFRIDNLRELLTDSAETEGVEVEPRMSNAFWPGFMFKVSRAIEGKQRKCRLSLYMLPG
DYSTPTIAVYASVSVQSLLGNHTYSTKALKRQATFDHGRTTIGTLLSQKMYEASYTMQRE
NAAIVLVTLRSSNAPTPRSSPTLNLIHRVLTARPISNTRFIVFRRRDSTGRLSCPRAFYA
NMKDLASHYERCEDLLNIENSIEGFELPVGASLDDYSLTCDQHDYDSDFERDEEEDDEDD
DIVVVQSENCRQRARRPLPGGTPADSMIADDSVTLESIQAEVEASMQSSTDSFDIINPRE
GVDLYSPSEFEGTTIVLLGAAARTVAHSWEALLYYLYTGFIDFAPLTSLNPKGQDEFLAR
YRSGNPHRPLPPSCRSIYRLAHMLELDGLRKLALEYLESQLTPETLLTEVFSEFTTRYDE
VKEMELALVVRYWHALKASSAFKNKMVEVTSGSVPHAADIISEIMMRVSAQKA
Download sequence
Identical sequences 104341.JGI130503 jgi|Pospl1|130503|estExt_fgenesh3_pg.C_970050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]