SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|19025|gw1.6.4.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|19025|gw1.6.4.1
Domain Number 1 Region: 1060-1262
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.08e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000391
Further Details:      
 
Domain Number 2 Region: 988-1043
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000837
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|19025|gw1.6.4.1
Domain Number - Region: 58-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00246
Family LIM domain 0.023
Further Details:      
 
Domain Number - Region: 86-128
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00879
Family Cytochrome c3-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|19025|gw1.6.4.1
Sequence length 1262
Sequence
PSLSTENGFCPGCKKSVVDENGGVVVAFGQSFFHVDCFKCAKCGNQVTADTNLLLLSDGS
PICANCSYSCNVCKLPILDEAIMTGDDSYHAHCFKCKVCKNRIDELVFAKTSQGIYCMNC
HNQRVARSRRHAQRQREKEQERQRERERAAAALTAPGTTGADTSSRRDQSDGAASPASTT
TKSPPTALPLSKRPSTAATAEPARSSTYDSSVQSSLGRSVVPSGSRADSLAVPDGSDRSL
LSRKSFDGGVRPPLRTTPSANSLSTTASSSSYGLGIPNGETSRKDKRRSINPAMALGSSS
TVSSPANVTPSSFLPSPSSAHDPRPSSPFHDYFTAGHTMSPPTHTDNADFTPFSRMGASS
TRPSTPLSARGSIEHGGQRERTYSGPTPYRSLEQTPRGPSRSGPGLPSRPNARPDHLRES
PSAGGLPSRPSSIPTPTSPSHRVDVPHGIESGTDTEAESDEHRMTTEPESMLDLPPALPP
KDSPSGKPGMRPPLLRLDTADIRRDTSDARRLDSEEPTDSPESSPVERTSHATFIAPALP
PIRISMGGTDFSELLKSVGGNVLKLDQIAETTKEGGRKLDLSAASPSAFMASDNSAHSRT
LGGSSHAPSPTSTLDENNAIRRSLDALSGRRDSLTSSTHTHIKVTAPDNGPEPLRTSLSD
SLMRQLQDIVTYAADEGSPHVVLELDLAQTLLKLLAEEKDAYNDLKRKFDGMRRASQRYE
DGLTVAQTEYDRELKGRRDAEAEVTRLRVLLSGQAVRLSAISADTKRQEAQKQLSEELSK
NLSDLGRSVSKLKVDRDLVLAEVEQLSASKSSPAVDNEDGAGSFTRALSMRFDNIKNQYQ
HELLPLTEQREALMREITELKASREAFLEETTVLNARNEELAQLNAQYVRRLEAVGLDSS
AARNDNSSQEGSDMTHDRYRQIQDLSSSVTSSTVAFTEESAESKFIKVSKPDVMEMPGPQ
TKAGKFIKWPGHKTPKENLPMVSWPEPSKPKGGKEHAFQQISVLRVARCDHCGDKMWGSQ
YRCTGCNFAVHIRCLPHVQSTCSQQGVNSRDEPSRPLAPLPPSMFGRDLTEQVRAEARDE
PRPIPILVEKCIEAVDALALDLEGIYRKTGGSSQVKMITQLFERQEYRTFDLCDTERFND
ICSVTSVLKTYLRSLPDPLMTYALHAKFTSAANIRDPEAKSKALLESVNELPKEHYYTTR
ALMLHLHRVSLHADVNRMNARNLGVVFGPTLMRSRDFVNEFGDMAGSTLCMEWLIENAPS
VF
Download sequence
Identical sequences B8P0Y7
jgi|Pospl1|19025|gw1.6.4.1 XP_002469370.1.31404 104341.JGI19025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]