SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|23324|gw1.151.9.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|23324|gw1.151.9.1
Domain Number 1 Region: 306-390
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|23324|gw1.151.9.1
Sequence length 415
Sequence
MPIHDVVRQRLQPFTSAVTSNRILLYSVFGTAALVGTVANACRTYSNFYSVTIYLSRSSR
SVLVLANFGLLVGLLCGRVMQRLFFGPLQPREVERLYDQTWIFVTESLLAFTIFRDDFDI
PFVLMFGFLLFVKCFHWLMADRVETMDQTTYPGPPLIFHIRMNLLFTLLTSIDFVMFVLA
VESTLNYGVGGMVLFASEYAILLASAMNSIARYILSVVDLRRARSRGGENAPPMENKSMY
VFYIELITDFLKLVTYLTFFMLILTFYGLPLNIVRDVYLTARSFITRLRALIRYHNATRD
MDRRYPNATEAELAQMSDRTCIICREEMVSRIPAPNGAEAPAAPPQDGPNMTPKKLPCGH
IFHFQCLRSWLERQQSCPTCRRPVLETTPNPRNQPQAQGRQGGVGPGIAPQPGQQ
Download sequence
Identical sequences A0A1X6NDP5 B8PIA2
104341.JGI23324 XP_002475410.1.31404 jgi|Pospl1|23324|gw1.151.9.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]