SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|24325|gw1.110.6.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|24325|gw1.110.6.1
Domain Number 1 Region: 121-150
Classification Level Classification E-value
Superfamily RING/U-box 0.0000318
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|24325|gw1.110.6.1
Domain Number - Region: 4-61
Classification Level Classification E-value
Superfamily RING/U-box 0.00565
Family RING finger domain, C3HC4 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|24325|gw1.110.6.1
Sequence length 150
Sequence
DEVRAPCGDYHDRGCIVAMFKAAMQDQLLFPPRCCRKRIPLASVQQFLSAELVESYQAKE
KESGTLKDVYCTNPSCSLFLCAQVKGALWRCCRTHTCSHCRGAVHPGRGHRCEHDSGQKA
VLELASQKGWARCPACDQMIELRSGCYHMT
Download sequence
Identical sequences B8PF99
XP_002474338.1.31404 104341.JGI24325 jgi|Pospl1|24325|gw1.110.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]