SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|26921|gw1.180.12.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|26921|gw1.180.12.1
Domain Number 1 Region: 4-40
Classification Level Classification E-value
Superfamily RING/U-box 0.00000177
Family RING finger domain, C3HC4 0.044
Further Details:      
 
Domain Number 2 Region: 144-173
Classification Level Classification E-value
Superfamily RING/U-box 0.0000215
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|26921|gw1.180.12.1
Domain Number - Region: 82-134
Classification Level Classification E-value
Superfamily RING/U-box 0.053
Family RING finger domain, C3HC4 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|26921|gw1.180.12.1
Sequence length 173
Sequence
SRKSHDCVICQCPIEGVQVRVPCGHYFDVPCLINLVEAATRDESLFPPSCCQQRILDRSF
TRFMPPVLRDVFAVKDVEFSTTCRVYCAKPSCSRFLGARRKDSFAPVLSCPSPGCRTHTC
SHCRGAVHPGRGHRCEHDSGQKAVLELASQKGWARCPACDQMIELRSGCYHMT
Download sequence
Identical sequences B8PJT4
jgi|Pospl1|26921|gw1.180.12.1 104341.JGI26921 XP_002475945.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]