SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|28204|gw1.137.35.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|28204|gw1.137.35.1
Domain Number 1 Region: 55-108
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.57e-18
Family Erythroid transcription factor GATA-1 0.0012
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000076
Family Erythroid transcription factor GATA-1 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|28204|gw1.137.35.1
Sequence length 111
Sequence
CANCGAEVTPLWRRDGVGKTVCNACGLYYKAHGSSRPGTISSGGRSRMRAAVGALSCANC
GTSTTPLWRRDDVGNNICNACGLYFKLHGTHRPNSMKKTVIKRRKRVPAAP
Download sequence
Identical sequences A0A1X6N659 B8PHC3
jgi|Pospl1|28204|gw1.137.35.1 104341.JGI28204 XP_002475082.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]