SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|34748|gw1.63.49.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|34748|gw1.63.49.1
Domain Number 1 Region: 224-266
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000196
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 2 Region: 157-188
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000072
Family CCCH zinc finger 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|34748|gw1.63.49.1
Sequence length 319
Sequence
FKKKGRGRPATARKRSASPPASVLTVPVPSSSKTEVVLPSRKQAANLLSAGTKRTAAQRD
EDAHSDQEPEREGPDMKWTAAGSHVNAALEILQGDEAAAILAKRRRTEPTDDESVPDDGL
YHGQKAYANHIKKNQEVPKAMRVGPQRPNSSTIRTVTIVDYQPDVCKDYKETGYCGYGDT
CKFLHDRGTYLAGWQLDKLAENPRKQVEDVSDTDSDDDNDLPYSCYICRKPFTDPVVTRC
GHYFCSACAIKRFSKTPKCAVCFAPTAGIFNRADKVLEKMKKVQAEKGADEADGGGDDTK
TVEIEGLQQGSDSESGSDE
Download sequence
Identical sequences B8PAL7
jgi|Pospl1|34748|gw1.63.49.1 XP_002472721.1.31404 104341.JGI34748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]